| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 58.6 | 1.1e-18 | 161 | 215 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
rk+ +++keq +Lee F+++++++ +++ LAk+l+L +rqV vWFqNrRa+ k
AT3G60390.1 161 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTK 215
788899***********************************************98 PP
|
| 2 | HD-ZIP_I/II | 122.8 | 1.6e-39 | 161 | 250 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
+kk+rlskeq+ +LEe+F+e+++L+p++K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr +l
AT3G60390.1 161 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELR-AL 250
69*************************************************************************************9.55 PP
|
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Jiao Y, et al.
A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development. Plant Physiol., 2003. 133(4): p. 1480-93 [PMID:14605227] - DeCook R,Lall S,Nettleton D,Howell SH
Genetic regulation of gene expression during shoot development in Arabidopsis. Genetics, 2006. 172(2): p. 1155-64 [PMID:15956669] - Nakayama N, et al.
Gene trap lines define domains of gene regulation in Arabidopsis petals and stamens. Plant Cell, 2005. 17(9): p. 2486-506 [PMID:16055634] - Henriksson E, et al.
Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] - Tan QK,Irish VF
The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development. Plant Physiol., 2006. 140(3): p. 1095-108 [PMID:16428600] - Cao D,Cheng H,Wu W,Soo HM,Peng J
Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] - Heyl A, et al.
The transcriptional repressor ARR1-SRDX suppresses pleiotropic cytokinin activities in Arabidopsis. Plant Physiol., 2008. 147(3): p. 1380-95 [PMID:18502977] - Ciarbelli AR, et al.
The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy. Plant Mol. Biol., 2008. 68(4-5): p. 465-78 [PMID:18758690] - Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF
ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings. Plant J., 2009. 59(2): p. 266-77 [PMID:19392702] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Bou-Torrent J, et al.
ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis. Plant Signal Behav, 2012. 7(11): p. 1382-7 [PMID:22918502] - Turchi L, et al.
Arabidopsis HD-Zip II transcription factors control apical embryo development and meristem function. Development, 2013. 140(10): p. 2118-29 [PMID:23578926] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Zou LJ, et al.
Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus. Plant Cell Physiol., 2016. 57(9): p. 1879-89 [PMID:27328697] - Caggiano MP, et al.
Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] - Schena M,Davis RW
Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families. Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7 [PMID:7915839]
|