PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G66656.1

Common Name

AGL91, T8E24.5

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 178aa MW: 20374 Da PI: 7.389

Description

AGAMOUS-like 91

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G66656.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	60.6	1.9e-19	11	57	3	49
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 ++++ +qvtfskRr g++KKA+EL +LC+aev +++fs+ +k y + AT3G66656.1 11 VQDTNTKQVTFSKRRLGLFKKASELATLCNAEVGIVVFSPGNKPYSF 57 6788899*********************************9998877 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.1E-32	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.98E-26	1	74	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	25.105	1	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-18	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.6E-23	11	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-18	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-18	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009005	anatomy	root
PO:0009089	anatomy	endosperm

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MGRRKIKMEK VQDTNTKQVT FSKRRLGLFK KASELATLCN AEVGIVVFSP GNKPYSFGKP 60 NFDVIAERFK NEFEEEEEGD SCETSGYSRG NRARQEKKIC KRLNSITEEA EAEKKHGEDL 120 HKWLESAEQD KFNKPIEELT LEELKEFEAK IKKISCGIQS NISHMQASSS LMFLSNDN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	6e-16	1	79	1	78	MEF2 CHIMERA
6byy_B	6e-16	1	79	1	78	MEF2 CHIMERA
6byy_C	6e-16	1	79	1	78	MEF2 CHIMERA
6byy_D	6e-16	1	79	1	78	MEF2 CHIMERA
6bz1_A	7e-16	1	79	1	78	MEF2 CHIMERA
6bz1_B	7e-16	1	79	1	78	MEF2 CHIMERA
6bz1_C	7e-16	1	79	1	78	MEF2 CHIMERA
6bz1_D	7e-16	1	79	1	78	MEF2 CHIMERA
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	256247_at	0.0
Expression Atlas	AT3G66656	-
AtGenExpress	AT3G66656	-
ATTED-II	AT3G66656	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During embryogenesis, expressed in the chalazal endosperm. {ECO:0000269\|PubMed:20631316}.
Uniprot	TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269\|PubMed:12949148}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G66656.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G66656

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC036106	0.0	AC036106.6 Arabidopsis thaliana chromosome 3 BAC T8E24 genomic sequence, complete sequence.
GenBank	CP002686	0.0	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBank	DQ056634	0.0	DQ056634.1 Arabidopsis thaliana MADS-box family protein (At3g66656) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_187320.1	1e-128	AGAMOUS-like 91
Swissprot	O64703	6e-63	AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBL	A0A384L204	1e-127	A0A384L204_ARATH; AGL91
TrEMBL	Q9C836	1e-127	Q9C836_ARATH; AGAMOUS-like 91
STRING	AT3G66656.1	1e-128	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM86	28	390
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT3G66656.1
Entrez Gene	819848
iHOP	AT3G66656
wikigenes	AT3G66656

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Lee BH,Henderson DA,Zhu JK The Arabidopsis cold-responsive transcriptome and its regulation by ICE1. Plant Cell, 2005. 17(11): p. 3155-75 [PMID:16214899] Day RC,Herridge RP,Ambrose BA,Macknight RC Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation. Plant Physiol., 2008. 148(4): p. 1964-84 [PMID:18923020] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]