| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 56.6 | 5.8e-18 | 217 | 263 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT+eEd l+++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
AT4G18770.1 217 KGQWTAEEDRVLIQLVEKYGLRKWSHIAQVLP-GRIGKQCRERWHNHL 263
799*****************************.*************97 PP
|
| 2 | Myb_DNA-binding | 52.1 | 1.6e-16 | 269 | 311 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+ W++eEd l++ +k+ G++ W+ Ia++++ gRt++++k++w+
AT4G18770.1 269 KETWSEEEDRVLIEFHKEIGNK-WAEIAKRLP-GRTENSIKNHWN 311
578*******************.*********.***********8 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| TAIR | MYB98 is a member of the R2R3-MYB gene family, the members of which likely encode transcription factors. Within an ovule, MYB98 is expressed exclusively in the synergid cells, and mutations in this gene affect the female gametophyte specifically. myb98 female gametophytes are affected in two unique features of the synergid cell, pollen tube guidance and the filiform apparatus, but are otherwise normal. This suggests that MYB98 controls the development of specific features within the synergid cell during female gametophyte development. MYB98 also is expressed in trichomes and endosperm. Homozygous myb98 mutants exhibit no sporophytic defects, including trichome and endosperm defects. |
| UniProt | Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}. |
| Publications
? help Back to Top |
- Kranz H,Scholz K,Weisshaar B
c-MYB oncogene-like genes encoding three MYB repeats occur in all major plant lineages. Plant J., 2000. 21(2): p. 231-5 [PMID:10743663] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Kasahara RD,Portereiko MF,Sandaklie-Nikolova L,Rabiger DS,Drews GN
MYB98 is required for pollen tube guidance and synergid cell differentiation in Arabidopsis. Plant Cell, 2005. 17(11): p. 2981-92 [PMID:16214903] - Yu HJ,Hogan P,Sundaresan V
Analysis of the female gametophyte transcriptome of Arabidopsis by comparative expression profiling. Plant Physiol., 2005. 139(4): p. 1853-69 [PMID:16299181] - Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] - Steffen JG,Kang IH,Macfarlane J,Drews GN
Identification of genes expressed in the Arabidopsis female gametophyte. Plant J., 2007. 51(2): p. 281-92 [PMID:17559508] - Punwani JA,Rabiger DS,Drews GN
MYB98 positively regulates a battery of synergid-expressed genes encoding filiform apparatus localized proteins. Plant Cell, 2007. 19(8): p. 2557-68 [PMID:17693534] - Johnston AJ, et al.
Genetic subtraction profiling identifies genes essential for Arabidopsis reproduction and reveals interaction between the female gametophyte and the maternal sporophyte. Genome Biol., 2007. 8(10): p. R204 [PMID:17915010] - Jones-Rhoades MW,Borevitz JO,Preuss D
Genome-wide expression profiling of the Arabidopsis female gametophyte identifies families of small, secreted proteins. PLoS Genet., 2007. 3(10): p. 1848-61 [PMID:17937500] - Punwani JA,Rabiger DS,Lloyd A,Drews GN
The MYB98 subcircuit of the synergid gene regulatory network includes genes directly and indirectly regulated by MYB98. Plant J., 2008. 55(3): p. 406-14 [PMID:18410484] - Wuest SE, et al.
Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes. Curr. Biol., 2010. 20(6): p. 506-12 [PMID:20226671] - Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
14-3-3 proteins fine-tune plant nutrient metabolism. FEBS Lett., 2011. 585(1): p. 143-7 [PMID:21094157] - Causier B,Ashworth M,Guo W,Davies B
The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] - Iwano M, et al.
Cytoplasmic Ca2+ changes dynamically during the interaction of the pollen tube with synergid cells. Development, 2012. 139(22): p. 4202-9 [PMID:23093426] - Mendes MA, et al.
Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis. Development, 2016. 143(15): p. 2780-90 [PMID:27338615]
|