PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G21030.1

Common Name

ATDOF4;2, ATDOF4.2, DOF4.2, T13K14.190

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

Dof

Protein Properties

Length: 194aa MW: 22107.6 Da PI: 5.5667

Description

Dof-type zinc finger domain-containing protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G21030.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	73	4.1e-23	21	74	6	59
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 + cprC s++t+f y+nn sqPry Ck+C r Wt+GG lrn+Pv g + k++ AT4G21030.1 21 RVCPRCYSDQTRFSYFNNNKKSQPRYKCKNCCRCWTHGGVLRNIPVTGICDKSN 74 68**********************************************998875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	1.0E-27	19	73	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	7.2E-22	21	73	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	22.583	21	75	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	23	59	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048359	Biological Process	mucilage metabolic process involved in seed coat development
GO:0048825	Biological Process	cotyledon development
GO:2000032	Biological Process	regulation of secondary shoot formation
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009001	anatomy	fruit

Sequence ? help Back to Top
Protein Sequence Length: 194 aa Download sequence Send to blast
MNNLNVFTNE DNEMNVMPPP RVCPRCYSDQ TRFSYFNNNK KSQPRYKCKN CCRCWTHGGV 60 LRNIPVTGIC DKSNLPKIDQ SSVSQMILAE IQQGNHQPFK KFQENISVSV SSSSDVSIVG 120 NHFDDLSELH GITNSTPIRS FTMDRLDFGE ESFQQDLYDV GSNDLIGNPL INQSIGGYVD 180 NHKDEHKLQF EYES

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT4G21030
AtGenExpress	AT4G21030

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
Data indicate that AtDOF4.2-overexpressing increased branching through the up-regulation of three branching-related genes, AtSTM (SHOOT MERISTEMLESS), AtTFL1 (TERMINAL FLOWER1) and AtCYP83B1 (CYTOCHROME P450 83B1). [PMID: 23095045]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00445	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G21030.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G21030

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AL080282	0.0	AL080282.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T13K14 (ESSA project).
GenBank	AL161554	0.0	AL161554.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 54.
GenBank	CP002687	0.0	CP002687.1 Arabidopsis thaliana chromosome 4 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_193835.1	1e-144	Dof-type zinc finger domain-containing protein
Swissprot	Q9SUB1	1e-145	DOF42_ARATH; Dof zinc finger protein DOF4.2
TrEMBL	D7MFF9	1e-92	D7MFF9_ARALL; Uncharacterized protein
STRING	AT4G21030.1	1e-143	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1602	17	89
Representative plant	OGRP38	17	445

Link Out ? help Back to Top
Phytozome	AT4G21030.1
Entrez Gene	827850
iHOP	AT4G21030
wikigenes	AT4G21030

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yanagisawa S The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] Lijavetzky D,Carbonero P,Vicente-Carbajosa J Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] Kersten B, et al. Generation of Arabidopsis protein chips for antibody and serum screening. Plant Mol. Biol., 2003. 52(5): p. 999-1010 [PMID:14558660] Yang X,Tuskan GA,Cheng MZ Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication. Plant Physiol., 2006. 142(3): p. 820-30 [PMID:16980566] Skirycz A, et al. Transcription factor AtDOF4;2 affects phenylpropanoid metabolism in Arabidopsis thaliana. New Phytol., 2007. 175(3): p. 425-38 [PMID:17635218] Zou HF, et al. The transcription factor AtDOF4.2 regulates shoot branching and seed coat formation in Arabidopsis. Biochem. J., 2013. 449(2): p. 373-88 [PMID:23095045]