![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT4G24660.1 | ||||||||
| Common Name | ATHB22, F22K18.140, HB22, MEE68, ZHD2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 220aa MW: 24022.8 Da PI: 8.0189 | ||||||||
| Description | homeobox protein 22 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 107.3 | 9e-34 | 46 | 100 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
k+rY+eClkNhA+++GghavDGC+Efmps ge+gt +alkCaACgCHRnFHR+e+e
AT4G24660.1 46 KIRYRECLKNHAVNIGGHAVDGCCEFMPS-GEDGTLDALKCAACGCHRNFHRKETE 100
79**************************9.999********************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04770 | 8.8E-31 | 47 | 99 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| ProDom | PD125774 | 6.0E-27 | 47 | 101 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 2.5E-29 | 48 | 98 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 27.366 | 49 | 98 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Gene3D | G3DSA:1.10.10.60 | 3.8E-32 | 144 | 219 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.9E-20 | 145 | 218 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01565 | 2.1E-27 | 158 | 214 | IPR006455 | Homeodomain, ZF-HD class |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009793 | Biological Process | embryo development ending in seed dormancy | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000014 | anatomy | rosette leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 220 aa Download sequence Send to blast |
MNFEDQEEDM EMSGVNPPCG YDSLSGEGAT SSGGGGVGRS KGVGAKIRYR ECLKNHAVNI 60 GGHAVDGCCE FMPSGEDGTL DALKCAACGC HRNFHRKETE SIGGRAHRVP TYYNRPPQPH 120 QPPGYLHLTS PAAPYRPPAA SGDEEDTSNP SSSGGTTKRF RTKFTAEQKE KMLAFAERLG 180 WRIQKHDDVA VEQFCAETGV RRQVLKIWMH NNKNSLGKKP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wh7_A | 8e-45 | 148 | 215 | 8 | 75 | ZF-HD homeobox family protein |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.2543 | 0.0 | cell culture| inflorescence | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 254132_at | 0.0 | ||||
| Expression Atlas | AT4G24660 | - | ||||
| AtGenExpress | AT4G24660 | - | ||||
| ATTED-II | AT4G24660 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in flowers and, to a lower extent, in inflorescence, stems and leaves. {ECO:0000269|PubMed:16428600}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Essential protein. Putative transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT4G24660.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search Q9SB61 | |||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: Arrested at early embryo stages. {ECO:0000269|PubMed:15634699}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT4G24660 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF439841 | 0.0 | AF439841.1 Arabidopsis thaliana AT4g24660/F22K18_140 mRNA, complete cds. | |||
| GenBank | AL035356 | 0.0 | AL035356.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F22K18 (ESSAII project). | |||
| GenBank | AL161561 | 0.0 | AL161561.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 61. | |||
| GenBank | AY125563 | 0.0 | AY125563.1 Arabidopsis thaliana AT4g24660/F22K18_140 mRNA, complete cds. | |||
| GenBank | CP002687 | 0.0 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_194197.1 | 1e-166 | homeobox protein 22 | ||||
| Swissprot | Q9SB61 | 1e-167 | ZHD2_ARATH; Zinc-finger homeodomain protein 2 | ||||
| TrEMBL | A0A178UZW1 | 1e-165 | A0A178UZW1_ARATH; ZHD2 | ||||
| STRING | AT4G24660.1 | 1e-166 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4505 | 24 | 54 | Representative plant | OGRP91 | 16 | 237 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT4G24660.1 |
| Entrez Gene | 828568 |
| iHOP | AT4G24660 |
| wikigenes | AT4G24660 |




