![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT4G35040.1 | ||||||||
| Common Name | bZIP19, M4E13.100 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 261aa MW: 28665.8 Da PI: 5.6038 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 34.1 | 5.9e-11 | 91 | 138 | 5 | 52 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52
k e+r NReA r++R++Kka+ + Le++v+ L a N++L k+l++
AT4G35040.1 91 KGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQNQ 138
6799999***********************************999863 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 4.4E-11 | 87 | 154 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 8.864 | 89 | 155 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 3.8E-13 | 90 | 155 | No hit | No description |
| SuperFamily | SSF57959 | 6.06E-7 | 91 | 138 | No hit | No description |
| Pfam | PF07716 | 2.9E-14 | 91 | 144 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14686 | 1.92E-12 | 93 | 146 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0071294 | Biological Process | cellular response to zinc ion | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000084 | anatomy | plant sperm cell | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 261 aa Download sequence Send to blast |
MEDGELDFSN QEVFSSSEMG ELPPSNCSMD SFFDGLLMDT NAACTHTHTC NPTGPENTHT 60 HTCFHVHTKI LPDESDEKVS TDDTAESCGK KGEKRPLGNR EAVRKYREKK KAKAASLEDE 120 VARLRAVNQQ LVKRLQNQAT LEAEVSRLKC LLVDLRGRID GEIGSFPYQK PMAANIPSFS 180 HMMNPCNVQC DDEVYCPQNV FGVNSQEGAS INDQGLSGCD FDQLQCMANQ NLNGNGNGSF 240 SNVNTSVSNK RKGGHRASRA V |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.31451 | 0.0 | flower| inflorescence | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 186516398 | 0.0 | ||||
| Genevisible | 253171_at | 0.0 | ||||
| Expression Atlas | AT4G35040 | - | ||||
| AtGenExpress | AT4G35040 | - | ||||
| ATTED-II | AT4G35040 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Basic-region leucine zipper (bZIP19) transcription factor involved in the adaptation to zinc deficiency. Binds ZDRE motifs. | |||||
| UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT4G35040.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions (PubMed:20479230, PubMed:26306426). Mutant seedlings grown under normal conditions accumulate reduced levels of zinc in roots. Mutant seedlings grown in zinc-depleted medium have reduced root length (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT4G35040 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY072386 | 0.0 | AY072386.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds. | |||
| GenBank | BT000160 | 0.0 | BT000160.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001320139.1 | 0.0 | Basic-leucine zipper (bZIP) transcription factor family protein | ||||
| Refseq | NP_001328011.1 | 0.0 | Basic-leucine zipper (bZIP) transcription factor family protein | ||||
| Refseq | NP_001328012.1 | 0.0 | Basic-leucine zipper (bZIP) transcription factor family protein | ||||
| Refseq | NP_567974.1 | 0.0 | Basic-leucine zipper (bZIP) transcription factor family protein | ||||
| Swissprot | Q8VY76 | 0.0 | BZP19_ARATH; Basic leucine zipper 19 | ||||
| TrEMBL | A0A178UVU8 | 0.0 | A0A178UVU8_ARATH; BZIP19 | ||||
| STRING | AT4G35040.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2036 | 28 | 79 | Representative plant | OGRP1970 | 15 | 36 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT4G35040.1 |
| Entrez Gene | 829656 |
| iHOP | AT4G35040 |
| wikigenes | AT4G35040 |




