![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT5G02840.3 | ||||||||
| Common Name | F9G14.150, LCL1, RVE4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 283aa MW: 31195.3 Da PI: 6.262 | ||||||||
| Description | LHY/CCA1-like 1 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 39.2 | 1.6e-12 | 48 | 92 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
r +WT+ E++++++a +++ + Wk+I +g +t q++s+ qky
AT5G02840.3 48 RESWTEGEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 92
789*****************77.*********.*************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.87E-16 | 42 | 98 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 14.942 | 43 | 97 | IPR017930 | Myb domain |
| TIGRFAMs | TIGR01557 | 2.2E-18 | 46 | 95 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-6 | 46 | 98 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 7.6E-10 | 47 | 95 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.9E-10 | 48 | 92 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.24E-7 | 50 | 93 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007623 | Biological Process | circadian rhythm | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009723 | Biological Process | response to ethylene | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0046686 | Biological Process | response to cadmium ion | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000003 | anatomy | whole plant | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000014 | anatomy | rosette leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000084 | anatomy | plant sperm cell | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025195 | anatomy | pollen tube cell | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001016 | developmental stage | L mature pollen stage | ||||
| PO:0001017 | developmental stage | M germinated pollen stage | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007131 | developmental stage | seedling development stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 283 aa Download sequence Send to blast |
MTSTNPVVAE VIPAETSTDA TETTIATTEA GEAPEKKVRK AYTITKSRES WTEGEHDKFL 60 EALQLFDRDW KKIEDFVGSK TVIQIRSHAQ KYFLKVQKNG TLAHVPPPRP KRKAAHPYPQ 120 KASKNAQMSL HVSMSFPTQI NNLPGYTPWD DDTSALLNIA VSGVIPPEDE LDTLCGAEVD 180 VGSNDMISET SPSASGIGSS SRTLSDSKGL RLAKQAPSMH GLPDFAEVYN FIGSVFDPDS 240 KGRMKKLKEM DPINFETVLL LMRNLTVNLS NPDFEPTRKV MNT |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.20108 | 0.0 | flower| leaf| root| seed| silique | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 145357565 | 0.0 | ||||
| Genevisible | 250972_at | 0.0 | ||||
| Expression Atlas | AT5G02840 | - | ||||
| AtGenExpress | AT5G02840 | - | ||||
| ATTED-II | AT5G02840 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | CCA1 and LHY colocalize in the nucleus and form heterodimers in vivo. CCA1 and LHY function synergistically in regulating circadian rhythms of Arabidopsis. | |||||
| UniProt | Probable transcription factor. {ECO:0000250, ECO:0000269|PubMed:17363273}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00484 | DAP | 27203113 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT5G02840.3 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Regulation -- Hormone ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hormone | |||||
| AHD | abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT5G02840 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK317012 | 0.0 | AK317012.1 Arabidopsis thaliana AT5G02840 mRNA, complete cds, clone: RAFL16-09-C03. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001031823.1 | 0.0 | LHY/CCA1-like 1 | ||||
| Swissprot | Q6R0G4 | 0.0 | RVE4_ARATH; Protein REVEILLE 4 | ||||
| TrEMBL | A0A178U8Z5 | 0.0 | A0A178U8Z5_ARATH; LCL1 | ||||
| STRING | AT5G02840.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT5G02840.3 |
| Entrez Gene | 831766 |
| iHOP | AT5G02840 |
| wikigenes | AT5G02840 |




