![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT5G03790.1 | ||||||||
| Common Name | ATHB51, ATHB-51, F17C15_210, HB51, LMI1, MED24.8 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 235aa MW: 26840.2 Da PI: 9.452 | ||||||||
| Description | homeobox 51 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 58.2 | 1.4e-18 | 78 | 130 | 4 | 56 |
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
+ ++t+ ql Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
AT5G03790.1 78 KKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK 130
45699***********************************************9 PP
| |||||||
| 2 | HD-ZIP_I/II | 116.3 | 1.8e-37 | 77 | 167 | 2 | 92 |
HD-ZIP_I/II 2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
kk+rl++ q+++LE+sF+ee kL+++rKv+l+reLglqprq+avWFqnrRAR+k+kqlE+ y++L+++yd +++e+++L++ev++Lr+ l+
AT5G03790.1 77 KKKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKAKQLEQLYDSLRQEYDVVSREKQMLHDEVKKLRALLR 167
9**************************************************************************************8775 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 3.12E-18 | 63 | 134 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-19 | 71 | 135 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 16.649 | 72 | 132 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 1.7E-16 | 74 | 136 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 4.45E-15 | 77 | 133 | No hit | No description |
| Pfam | PF00046 | 4.3E-16 | 78 | 130 | IPR001356 | Homeobox domain |
| PRINTS | PR00031 | 4.2E-5 | 103 | 112 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 107 | 130 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 4.2E-5 | 112 | 128 | IPR000047 | Helix-turn-helix motif |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009965 | Biological Process | leaf morphogenesis | ||||
| GO:0010434 | Biological Process | bract formation | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000229 | anatomy | flower meristem | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020128 | anatomy | leaf margin | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 235 aa Download sequence Send to blast |
MEWSTTSNVE NVRVAFMPPP WPESSSFNSL HSFNFDPYAG NSYTPGDTQT GPVISVPESE 60 KIMNAYRFPN NNNEMIKKKR LTSGQLASLE RSFQEEIKLD SDRKVKLSRE LGLQPRQIAV 120 WFQNRRARWK AKQLEQLYDS LRQEYDVVSR EKQMLHDEVK KLRALLRDQG LIKKQISAGT 180 IKVSGEEDTV EISSVVVAHP RTENMNANQI TGGNQVYGQY NNPMLVASSG WPSYP |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 124 | 132 | RRARWKAKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.54712 | 0.0 | flower | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 250915_at | 0.0 | ||||
| Expression Atlas | AT5G03790 | - | ||||
| AtGenExpress | AT5G03790 | - | ||||
| ATTED-II | AT5G03790 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a homeodomain leucine zipper class I (HD-Zip I) meristem identity regulator that acts together with LFY to induce CAL expression. It binds to the CAL promoter proximal CAATNATTG element. LMI1 acts primarily downstream of LFY in meristem identity regulation. The interaction between LFY, LMI1 and CAL resembles a feed-forward loop transcriptional network motif. The gene also had additional LFY-independent roles in leaf morphogenesis and bract formation. | |||||
| UniProt | Putative transcription factor. {ECO:0000250}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00486 | DAP | 27203113 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT5G03790.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator (A: Activate/R: Repress) | |||||
| ATRM | AT5G61850 (A) | |||||
| Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Target Gene (A: Activate/R: Repress) | |||||
| ATRM | AT1G26310(A) | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT5G03790 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB005235 | 0.0 | AB005235.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MED24. | |||
| GenBank | AL162506 | 0.0 | AL162506.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F17C15 (ESSA project). | |||
| GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_195999.2 | 1e-175 | homeobox 51 | ||||
| Swissprot | Q9LZR0 | 1e-176 | ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51 | ||||
| TrEMBL | A0A178UEZ7 | 1e-173 | A0A178UEZ7_ARATH; LMI1 | ||||
| STRING | AT5G03790.1 | 1e-175 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1660 | 28 | 88 | Representative plant | OGRP129 | 16 | 189 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT5G03790.1 |
| Entrez Gene | 831723 |
| iHOP | AT5G03790 |
| wikigenes | AT5G03790 |




