PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G05770.1

Common Name

WOX5A, WOX7

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WOX

Protein Properties

Length: 122aa MW: 13997 Da PI: 11.109

Description

WUSCHEL related homeobox 7

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G05770.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	63.8	2.5e-20	26	87	1	57
TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++ R+++t eq++ L +lF+ r+ps++++++++++l +++ ++V++WFqN++a+e++ AT5G05770.1 26 KCGRWNPTVEQVKLLTDLFKAgLRTPSTDQIQKISMELsfygKIESKNVFYWFQNHKARERQ 87 568***************99************************************97 PP
2	Wus_type_Homeobox	113.4	1.1e-36	26	88	2	64
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 ++ RW+Pt eQ+k+L++l+k+GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk AT5G05770.1 26 KCGRWNPTVEQVKLLTDLFKAGLRTPSTDQIQKISMELSFYGKIESKNVFYWFQNHKARERQK 88 578***********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	10.527	23	88	IPR001356	Homeobox domain
SMART	SM00389	8.2E-4	25	92	IPR001356	Homeobox domain
SuperFamily	SSF46689	3.72E-11	25	91	IPR009057	Homeodomain-like
Pfam	PF00046	2.3E-17	27	87	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	7.0E-8	29	87	IPR009057	Homeodomain-like
CDD	cd00086	0.00124	29	88	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007275	Biological Process	multicellular organism development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000060	anatomy	root cortex-endodermis initial cell
PO:0020127	anatomy	primary root

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MSSRGFNIKA RGLCNNNNGG GGTGAKCGRW NPTVEQVKLL TDLFKAGLRT PSTDQIQKIS 60 MELSFYGKIE SKNVFYWFQN HKARERQKCR KISTVKFDHR QDTDLSKPRR DNVRRHQLPA 120 KG

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT5G05770
AtGenExpress	AT5G05770

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box.
UniProt	Potential transcription factor that plays a central role during developmental processes. {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
WOX7 plays an important role in coupling the lateral root development program and sugar status. [PMID: 26621542] the expression switch from WOX11/12 to WOX5/7 is critical for initiation of the root primordium during de novo root organogenesis. [PMID: 27784768]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G05770.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G05770

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB005237	0.0	AB005237.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJJ3.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_196196.1	4e-88	WUSCHEL related homeobox 7
Swissprot	Q9FFK0	4e-89	WOX7_ARATH; WUSCHEL-related homeobox 7
TrEMBL	A0A089VA62	2e-86	A0A089VA62_ARATH; WOX7
STRING	AT5G05770.1	2e-87	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4014	28	57
Representative plant	OGRP8406	11	16

Link Out ? help Back to Top
Phytozome	AT5G05770.1
Entrez Gene	830462
iHOP	AT5G05770
wikigenes	AT5G05770

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] R Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes. Plant J., 2002. 32(2): p. 243-53 [PMID:12383089] Haecker A, et al. Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana. Development, 2004. 131(3): p. 657-68 [PMID:14711878] Conte MG,Gaillard S,Droc G,Perin C Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants. BMC Genomics, 2008. 9: p. 183 [PMID:18426584] Hirakawa Y,Kondo Y,Fukuda H TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis. Plant Cell, 2010. 22(8): p. 2618-29 [PMID:20729381] Zhang X,Zong J,Liu J,Yin J,Zhang D Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar. J Integr Plant Biol, 2010. 52(11): p. 1016-26 [PMID:20977659] Cui H, et al. Genome-wide direct target analysis reveals a role for SHORT-ROOT in root vascular patterning through cytokinin homeostasis. Plant Physiol., 2011. 157(3): p. 1221-31 [PMID:21951467] Lin H,Niu L,Tadege M STENOFOLIA acts as a repressor in regulating leaf blade outgrowth. Plant Signal Behav, 2013. 8(6): p. e24464 [PMID:23603965] Kong D,Hao Y,Cui H The WUSCHEL Related Homeobox Protein WOX7 Regulates the Sugar Response of Lateral Root Development in Arabidopsis thaliana. Mol Plant, 2016. 9(2): p. 261-270 [PMID:26621542] Hu X,Xu L Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis. Plant Physiol., 2016. 172(4): p. 2363-2373 [PMID:27784768]