| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 183.2 | 6.2e-57 | 3 | 128 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98
lppGfrFhPtdeel+++yL+kkv + +++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++
AT5G07680.2 3 LPPGFRFHPTDEELITHYLHKKVLDLGFSA-KAIGEVDLNKAEPWELPYKAKIGEKEWYFFCVRDRKYPTGLRTNRATQAGYWKATGKDKEIFR-GKS 98
79***************************9.89***************99999*****************************************.999 PP
NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128
lvg+kktLvfy+grapkg+kt+Wvmheyrl
AT5G07680.2 99 LVGMKKTLVFYRGRAPKGQKTNWVMHEYRL 128
****************************98 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1ut4_A | 3e-55 | 1 | 159 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-55 | 1 | 159 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-55 | 1 | 159 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-55 | 1 | 159 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 3e-55 | 1 | 159 | 18 | 174 | NAC domain-containing protein 19 |
| 3swm_B | 3e-55 | 1 | 159 | 18 | 174 | NAC domain-containing protein 19 |
| 3swm_C | 3e-55 | 1 | 159 | 18 | 174 | NAC domain-containing protein 19 |
| 3swm_D | 3e-55 | 1 | 159 | 18 | 174 | NAC domain-containing protein 19 |
| 3swp_A | 3e-55 | 1 | 159 | 18 | 174 | NAC domain-containing protein 19 |
| 3swp_B | 3e-55 | 1 | 159 | 18 | 174 | NAC domain-containing protein 19 |
| 3swp_C | 3e-55 | 1 | 159 | 18 | 174 | NAC domain-containing protein 19 |
| 3swp_D | 3e-55 | 1 | 159 | 18 | 174 | NAC domain-containing protein 19 |
| 4dul_A | 3e-55 | 1 | 159 | 15 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 3e-55 | 1 | 159 | 15 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Ooka H, et al.
Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] - Laufs P,Peaucelle A,Morin H,Traas J
MicroRNA regulation of the CUC genes is required for boundary size control in Arabidopsis meristems. Development, 2004. 131(17): p. 4311-22 [PMID:15294871] - Baker CC,Sieber P,Wellmer F,Meyerowitz EM
The early extra petals1 mutant uncovers a role for microRNA miR164c in regulating petal number in Arabidopsis. Curr. Biol., 2005. 15(4): p. 303-15 [PMID:15723790] - Guo HS,Xie Q,Fei JF,Chua NH
MicroRNA directs mRNA cleavage of the transcription factor NAC1 to downregulate auxin signals for arabidopsis lateral root development. Plant Cell, 2005. 17(5): p. 1376-86 [PMID:15829603] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Alvarez JP, et al.
Endogenous and synthetic microRNAs stimulate simultaneous, efficient, and localized regulation of multiple targets in diverse species. Plant Cell, 2006. 18(5): p. 1134-51 [PMID:16603651] - Nikovics K, et al.
The balance between the MIR164A and CUC2 genes controls leaf margin serration in Arabidopsis. Plant Cell, 2006. 18(11): p. 2929-45 [PMID:17098808] - Lee J, et al.
Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development. Plant Cell, 2007. 19(3): p. 731-49 [PMID:17337630] - Ehrenreich IM,Purugganan MD
Sequence variation of MicroRNAs and their binding sites in Arabidopsis. Plant Physiol., 2008. 146(4): p. 1974-82 [PMID:18305205] - Raman S, et al.
Interplay of miR164, CUP-SHAPED COTYLEDON genes and LATERAL SUPPRESSOR controls axillary meristem formation in Arabidopsis thaliana. Plant J., 2008. 55(1): p. 65-76 [PMID:18346190] - Efroni I, et al.
Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] - Vidal EA,Moyano TC,Riveras E,Contreras-L
Systems approaches map regulatory networks downstream of the auxin receptor AFB3 in the nitrate response of Arabidopsis thaliana roots. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(31): p. 12840-5 [PMID:23847199] - Pei H, et al.
An NAC transcription factor controls ethylene-regulated cell expansion in flower petals. Plant Physiol., 2013. 163(2): p. 775-91 [PMID:23933991] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Vidal EA,Álvarez JM,Gutiérrez RA
Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function. Plant Signal Behav, 2014. 9(3): p. e28501 [PMID:24642706] - Lee MH,Jeon HS,Kim HG,Park OK
An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164. New Phytol., 2017. 214(1): p. 343-360 [PMID:28032643]
|