![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT5G12840.2 | ||||||||
| Common Name | ATHAP2A, AtNFYA1, EMB2220, HAP2A, NFYA1, NF-YA1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 271aa MW: 29938.8 Da PI: 6.6827 | ||||||||
| Description | nuclear factor Y, subunit A1 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 97.7 | 1.2e-30 | 170 | 226 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy++Il+RR++Rak+e e+k+ ++ rkpylheSRhkhA+rR+R+sgGrF
AT5G12840.2 170 QEPVYVNAKQYEGILRRRKARAKAELERKV-IRDRKPYLHESRHKHAMRRARASGGRF 226
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 4.4E-34 | 168 | 229 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.248 | 169 | 229 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.3E-27 | 171 | 226 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 4.0E-23 | 172 | 194 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 174 | 194 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 4.0E-23 | 203 | 226 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010262 | Biological Process | somatic embryogenesis | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0055046 | Biological Process | microgametogenesis | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000084 | anatomy | plant sperm cell | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001017 | developmental stage | M germinated pollen stage | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007131 | developmental stage | seedling development stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 271 aa Download sequence Send to blast |
MQSKPGRENE EEVNNHHAVQ QPMMYAEPWW KNNSFGVVPQ ARPSGIPSNS SSLDCPNGSE 60 SNDVHSASED GALNGENDGT WKDSQAATSS RSDNHGMEGN DPALSIRNMH DQPLVQPPEL 120 VGHYIACVPN PYQDPYYGGL MGAYGHQQLG FRPYLGMPRE RTALPLDMAQ EPVYVNAKQY 180 EGILRRRKAR AKAELERKVI RDRKPYLHES RHKHAMRRAR ASGGRFAKKS EVEAGEDAGG 240 RDRERGSATN SSGSEQVETD SNETLNSSGA P |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 2e-17 | 170 | 226 | 2 | 58 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 210 | 219 | RHKHAMRRAR |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.5280 | 0.0 | seed | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 250320_at | 0.0 | ||||
| Expression Atlas | AT5G12840 | - | ||||
| AtGenExpress | AT5G12840 | - | ||||
| ATTED-II | AT5G12840 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a subunit of CCAAT-binding complex, binds to CCAAT box motif present in some plant promoter sequences. One of three members of this class (HAP2A, HAP2B, HAP2C), it is expressed in vegetative and reproductive tissues. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT5G12840.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Regulation -- MicroRNA ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| miRTarBase | Regulated by ath-miR169a | |||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT5G38140, AT5G50480, AT5G63470, AT1G08970, AT1G54830, AT1G56170 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT5G12840 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK317299 | 0.0 | AK317299.1 Arabidopsis thaliana AT5G12840 mRNA, complete cds, clone: RAFL21-66-A21. | |||
| GenBank | Y13720 | 0.0 | Y13720.1 Arabidopsis thaliana mRNA for Hap2a transcription factor. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_850811.1 | 0.0 | nuclear factor Y, subunit A1 | ||||
| Refseq | NP_974774.1 | 0.0 | nuclear factor Y, subunit A1 | ||||
| Swissprot | Q9LXV5 | 0.0 | NFYA1_ARATH; Nuclear transcription factor Y subunit A-1 | ||||
| TrEMBL | B9DGV8 | 0.0 | B9DGV8_ARATH; AT5G12840 protein | ||||
| STRING | AT5G12840.3 | 0.0 | (Arabidopsis thaliana) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT5G12840.2 |
| Entrez Gene | 831124 |
| iHOP | AT5G12840 |
| wikigenes | AT5G12840 |




