| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 48 | 2.8e-15 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
rg+W++eEd +l d+++++G+g +W + + + g++R++k+c++rw++yl
AT5G23000.1 14 RGPWSPEEDSKLRDYIEKYGNGgNWISFPLKAGLRRCGKSCRLRWLNYL 62
89*********************************************97 PP
|
| 2 | Myb_DNA-binding | 41.9 | 2.3e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
g +++eEd ++ +++ G++ W+ Ia++++ gRt++++k++w++
AT5G23000.1 69 GDFSEEEDRIIFSLFAAIGSR-WSIIAAHLP-GRTDNDIKNYWNT 111
789******************.*********.***********97 PP
|
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Che P,Gingerich DJ,Lall S,Howell SH
Global and hormone-induced gene expression changes during shoot development in Arabidopsis. Plant Cell, 2002. 14(11): p. 2771-85 [PMID:12417700] - Kroymann J,Donnerhacke S,Schnabelrauch D,Mitchell-Olds T
Evolutionary dynamics of an Arabidopsis insect resistance quantitative trait locus. Proc. Natl. Acad. Sci. U.S.A., 2003. 100 Suppl 2: p. 14587-92 [PMID:14506289] - Hoth S, et al.
Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana. FEBS Lett., 2003. 554(3): p. 373-80 [PMID:14623097] - Ball L, et al.
Evidence for a direct link between glutathione biosynthesis and stress defense gene expression in Arabidopsis. Plant Cell, 2004. 16(9): p. 2448-62 [PMID:15308753] - Müller D,Schmitz G,Theres K
Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis. Plant Cell, 2006. 18(3): p. 586-97 [PMID:16461581] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Keller T,Abbott J,Moritz T,Doerner P
Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development. Plant Cell, 2006. 18(3): p. 598-611 [PMID:16473968] - Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] - Textor S,de Kraker JW,Hause B,Gershenzon J,Tokuhisa JG
MAM3 catalyzes the formation of all aliphatic glucosinolate chain lengths in Arabidopsis. Plant Physiol., 2007. 144(1): p. 60-71 [PMID:17369439] - Ehrenreich IM,Stafford PA,Purugganan MD
The genetic architecture of shoot branching in Arabidopsis thaliana: a comparative assessment of candidate gene associations vs. quantitative trait locus mapping. Genetics, 2007. 176(2): p. 1223-36 [PMID:17435248] - Jeifetz D,David-Schwartz R,Borovsky Y,Paran I
CaBLIND regulates axillary meristem initiation and transition to flowering in pepper. Planta, 2011. 234(6): p. 1227-36 [PMID:21773792] - Busch BL, et al.
Shoot branching and leaf dissection in tomato are regulated by homologous gene modules. Plant Cell, 2011. 23(10): p. 3595-609 [PMID:22039213] - Yang F,Wang Q,Schmitz G,M
The bHLH protein ROX acts in concert with RAX1 and LAS to modulate axillary meristem formation in Arabidopsis. Plant J., 2012. 71(1): p. 61-70 [PMID:22372440] - Chahtane H, et al.
A variant of LEAFY reveals its capacity to stimulate meristem development by inducing RAX1. Plant J., 2013. 74(4): p. 678-89 [PMID:23445516] - Schnaubelt D,Schulz P,Hannah MA,Yocgo RE,Foyer CH
A phenomics approach to the analysis of the influence of glutathione on leaf area and abiotic stress tolerance in Arabidopsis thaliana. Front Plant Sci, 2013. 4: p. 416 [PMID:24204368] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Guo D, et al.
The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis. Plant Cell, 2015. 27(11): p. 3112-27 [PMID:26578700] - Yu YT, et al.
Overexpression of the MYB37 transcription factor enhances abscisic acid sensitivity, and improves both drought tolerance and seed productivity in Arabidopsis thaliana. Plant Mol. Biol., 2016. 90(3): p. 267-79 [PMID:26646286] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]
|