PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G26170.1

Common Name

ATWRKY50, T19G15.20, WRKY50

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 173aa MW: 19291.2 Da PI: 6.3536

Description

WRKY DNA-binding protein 50

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G26170.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	101.8	3.9e-32	112	170	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ gCpvkk+ver+++dp++v++tYeg+Hnh+ AT5G26170.1 112 LDDGFKWRKYGKKMVKNSPHPRNYYKCSVDGCPVKKRVERDRDDPSFVITTYEGSHNHS 170 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	2.3E-34	99	171	IPR003657	WRKY domain
SuperFamily	SSF118290	7.06E-29	105	170	IPR003657	WRKY domain
PROSITE profile	PS50811	30.021	107	172	IPR003657	WRKY domain
SMART	SM00774	1.7E-37	112	171	IPR003657	WRKY domain
Pfam	PF03106	6.1E-26	113	169	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell

Sequence ? help Back to Top
Protein Sequence Length: 173 aa Download sequence Send to blast
MNDADTNLGS SFSDDTHSVF EFPELDLSDE WMDDDLVSAV SGMNQSYGYQ TSDVAGALFS 60 GSSSCFSHPE SPSTKTYVAA TATASADNQN KKEKKKIKGR VAFKTRSEVE VLDDGFKWRK 120 YGKKMVKNSP HPRNYYKCSV DGCPVKKRVE RDRDDPSFVI TTYEGSHNHS SMN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-27	99	169	4	74	Probable WRKY transcription factor 4
2lex_A	3e-27	99	169	4	74	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT5G26170
AtGenExpress	AT5G26170

Functional Description ? help Back to Top
Source	Description
TAIR	member of WRKY Transcription Factor; Group II-c
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
WRKY50 and WRKY51 proteins mediate both salicylic acid- and low-18:1-dependent repression of jasmonic acid signaling. [PMID: 21030507]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G26170.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q8VWQ5

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G26170

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY071847	0.0	AY071847.1 Arabidopsis thaliana WRKY transcription factor 50 (WRKY50) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_197989.2	1e-127	WRKY DNA-binding protein 50
Swissprot	Q8VWQ5	1e-128	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	C0SVQ6	1e-126	C0SVQ6_ARATH; Uncharacterized protein At5g26170 (Fragment)
STRING	AT5G26170.1	1e-127	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6121	27	47
Representative plant	OGRP14	17	875

Link Out ? help Back to Top
Phytozome	AT5G26170.1
Entrez Gene	832686
iHOP	AT5G26170
wikigenes	AT5G26170

Publications ? help Back to Top
Eulgem T,Rushton PJ,Robatzek S,Somssich IE The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Chen IP,Haehnel U,Altschmied L,Schubert I,Puchta H The transcriptional response of Arabidopsis to genotoxic stress - a high-density colony array study (HDCA). Plant J., 2003. 35(6): p. 771-86 [PMID:12969430] Hoth S, et al. Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana. FEBS Lett., 2003. 554(3): p. 373-80 [PMID:14623097] Hass C, et al. The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis. EMBO J., 2004. 23(16): p. 3290-302 [PMID:15282545] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Gao QM,Venugopal S,Navarre D,Kachroo A Low oleic acid-derived repression of jasmonic acid-inducible defense responses requires the WRKY50 and WRKY51 proteins. Plant Physiol., 2011. 155(1): p. 464-76 [PMID:21030507] Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Pi L, et al. Organizer-Derived WOX5 Signal Maintains Root Columella Stem Cells through Chromatin-Mediated Repression of CDF4 Expression. Dev. Cell, 2015. 33(5): p. 576-88 [PMID:26028217]