PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G26930.1
Common NameF2P16.190, F2P16.9, GATA23
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 120aa    MW: 13238.7 Da    PI: 10.74
Description GATA transcription factor 23
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G26930.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-182862135
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                 Cs C+ttkTp+WR gp g+k+LCnaCG+++rk+++
  AT5G26930.1 28 CSECKTTKTPMWRGGPTGPKSLCNACGIRHRKQRR 62
                 ********************************985 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.33E-131962No hitNo description
PROSITE profilePS5011412.1892258IPR000679Zinc finger, GATA-type
SMARTSM004017.4E-172278IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.6E-162662IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.0E-162862IPR000679Zinc finger, GATA-type
CDDcd002026.32E-102862No hitNo description
PROSITE patternPS0034402853IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000036anatomyleaf vascular system
PO:0000052anatomypetiole vascular system
PO:0005028anatomyinflorescence vascular system
PO:0005352anatomyxylem
PO:0006036anatomyroot epidermis
PO:0006203anatomypericycle
PO:0008003anatomyfruit vascular system
PO:0009005anatomyroot
PO:0020139anatomyleaf midvein
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MDPRKLLSCS SSYVSVRMKE EKGTIRCCSE CKTTKTPMWR GGPTGPKSLC NACGIRHRKQ  60
RRSELLGIHI IRSHKSLASK KINLLSSSHG GVAVKKRRSL KEEEQAALCL LLLSCSSVLA
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246798_at0.0
Expression AtlasAT5G26930-
AtGenExpressAT5G26930-
ATTED-IIAT5G26930-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G26930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G26930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0247890.0BT024789.1 Arabidopsis thaliana At5g26930 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198045.12e-80GATA transcription factor 23
SwissprotQ8LC591e-81GAT23_ARATH; GATA transcription factor 23
TrEMBLC0SVQ84e-79C0SVQ8_ARATH; Uncharacterized protein At5g26930 (Fragment)
STRINGAT5G26930.16e-80(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144841622
Representative plantOGRP6817287
Publications ? help Back to Top
  1. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  2. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  3. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  4. AbuQamar S, et al.
    Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection.
    Plant J., 2006. 48(1): p. 28-44
    [PMID:16925600]
  5. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  6. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  7. De Rybel B, et al.
    A novel aux/IAA28 signaling cascade activates GATA23-dependent specification of lateral root founder cell identity.
    Curr. Biol., 2010. 20(19): p. 1697-706
    [PMID:20888232]
  8. Singh S,Singh A,Roy S,Sarkar AK
    SWP1 negatively regulates lateral root initiation and elongation in Arabidopsis.
    Plant Signal Behav, 2012. 7(12): p. 1522-5
    [PMID:23073020]
  9. Behringer C,Bastakis E,Ranftl QL,Mayer KF,Schwechheimer C
    Functional diversification within the family of B-GATA transcription factors through the leucine-leucine-methionine domain.
    Plant Physiol., 2014. 166(1): p. 293-305
    [PMID:25077795]
  10. Murphy E, et al.
    RALFL34 regulates formative cell divisions in Arabidopsis pericycle during lateral root initiation.
    J. Exp. Bot., 2016. 67(16): p. 4863-75
    [PMID:27521602]