![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT5G27910.1 | ||||||||
| Common Name | F14I23.70, F15F15.1, NFYC8, NF-YC8 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 187aa MW: 20609.4 Da PI: 4.4286 | ||||||||
| Description | nuclear factor Y, subunit C8 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 168.6 | 7.3e-53 | 17 | 115 | 1 | 99 |
NF-YC 1 qlksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
qlksfw+k++e + dfknh+lP++rikki+k+d+dv+mi++eaP+llskace+fi++lt+rswlha+e+kr tl+ks+++aav++t+ifdfl+d+ ++
AT5G27910.1 17 QLKSFWSKEMEGNLDFKNHDLPITRIKKIMKYDPDVTMIASEAPILLSKACEMFIMDLTMRSWLHAQESKRVTLQKSNVDAAVAQTVIFDFLLDDDIE 114
89********************************************************************************************9876 PP
NF-YC 99 d 99
AT5G27910.1 115 V 115
5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 3.19E-28 | 2 | 108 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 6.6E-30 | 29 | 99 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.9E-18 | 37 | 99 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0003011 | anatomy | root vascular system | ||||
| PO:0009005 | anatomy | root | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 187 aa Download sequence Send to blast |
MENNNGNNQL PPKGNEQLKS FWSKEMEGNL DFKNHDLPIT RIKKIMKYDP DVTMIASEAP 60 ILLSKACEMF IMDLTMRSWL HAQESKRVTL QKSNVDAAVA QTVIFDFLLD DDIEVKRESV 120 AAAADPVAMP PIDDGELPPG MVIGTPVCCS LGIHQPQPQM QAWPGAWTSV SGEEEEARGK 180 KGGDDGN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 3e-35 | 24 | 110 | 5 | 91 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 246754_at | 0.0 | ||||
| Expression Atlas | AT5G27910 | - | ||||
| AtGenExpress | AT5G27910 | - | ||||
| ATTED-II | AT5G27910 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT5G27910.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT5G47640, AT5G47670, AT1G09030, AT1G21970 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT5G27910 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC007399 | 0.0 | AC007399.1 Arabidopsis thaliana BAC F14I23 from chromosome V near 69 cM, complete sequence. | |||
| GenBank | AC007627 | 0.0 | AC007627.3 Genomic Sequence For Arabidopsis thaliana Clone F15F15, Chromosome V, complete sequence. | |||
| GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| GenBank | DQ056694 | 0.0 | DQ056694.1 Arabidopsis thaliana putative CCAAT-box binding transcription factor Hap5a (At5g27910) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_198143.1 | 1e-138 | nuclear factor Y, subunit C8 | ||||
| Swissprot | Q4PSE2 | 1e-139 | NFYC8_ARATH; Nuclear transcription factor Y subunit C-8 | ||||
| TrEMBL | C0SVR3 | 1e-136 | C0SVR3_ARATH; Uncharacterized protein At5g27910 (Fragment) | ||||
| STRING | AT5G27910.1 | 1e-137 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM17675 | 5 | 10 | Representative plant | OGRP315 | 17 | 117 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT5G27910.1 |
| Entrez Gene | 832857 |
| iHOP | AT5G27910 |
| wikigenes | AT5G27910 |




