![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT5G33210.1 | ||||||||
| Common Name | SRS8 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | SRS | ||||||||
| Protein Properties | Length: 173aa MW: 19542.7 Da PI: 9.3273 | ||||||||
| Description | SHI-related sequence 8 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF702 | 123.6 | 2.3e-38 | 46 | 140 | 2 | 96 |
DUF702 2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96
+sg++sCqd GnqakkdC+h+RCRtCCksrgf+C+thv+stWvpa+krrerqqqla+ + +++ + e+ +kr+re+ +++s+l +t+++ ++
AT5G33210.1 46 GSGGVSCQDFGNQAKKDCSHMRCRTCCKSRGFECSTHVRSTWVPATKRRERQQQLATVQPQTQLPRGESVPKRHRENLPATSSSLVCTRIPFHSG 140
57899*****************************************************99999999***********************998765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05142 | 2.0E-32 | 49 | 127 | IPR007818 | Protein of unknown function DUF702 |
| TIGRFAMs | TIGR01623 | 5.2E-26 | 51 | 93 | IPR006510 | Zinc finger, lateral root primordium type 1 |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| GO:0009734 | Biological Process | auxin-activated signaling pathway | ||||
| GO:0009851 | Biological Process | auxin biosynthetic process | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 173 aa Download sequence Send to blast |
MDMNMEKIFE DSVPCRVRAK RGCATHPRSI AERAAMMMIR SGGSGGSGGV SCQDFGNQAK 60 KDCSHMRCRT CCKSRGFECS THVRSTWVPA TKRRERQQQL ATVQPQTQLP RGESVPKRHR 120 ENLPATSSSL VCTRIPFHSG ICHCNVKYLF MCIYICLLLY GREIYNEMQA AFL |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 260079_s_at | 1e-34 | ||||
| Expression Atlas | AT5G33210 | - | ||||
| AtGenExpress | AT5G33210 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. SRS8 is a putative pseudogene. | |||||
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM) (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT5G33210.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT5G33210 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB046437 | 0.0 | AB046437.1 Arabidopsis thaliana DNA, chromosome 5 centromere region, clone:F11B20. | |||
| GenBank | AC069557 | 0.0 | AC069557.5 Genomic Sequence For Arabidopsis thaliana Clone T29A4 From Chromosome V, complete sequence. | |||
| GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_198306.1 | 1e-128 | SHI-related sequence 8 | ||||
| Swissprot | F4KH89 | 1e-129 | SRS8_ARATH; Protein SHI RELATED SEQUENCE 8 | ||||
| TrEMBL | F4KH88 | 7e-71 | F4KH88_ARATH; SHI-related sequence 8 | ||||
| STRING | AT5G33210.1 | 1e-127 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM22621 | 3 | 4 | Representative plant | OGRP1872 | 11 | 40 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT5G33210.1 |
| Entrez Gene | 833279 |
| iHOP | AT5G33210 |
| wikigenes | AT5G33210 |




