PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G33210.2
Common NameSRS8
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SRS
Protein Properties Length: 106aa    MW: 11737.3 Da    PI: 10.5943
Description SHI-related sequence 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G33210.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702127.12e-3911103294
       DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssa 94 
                  +sg++sCqd GnqakkdC+h+RCRtCCksrgf+C+thv+stWvpa+krrerqqqla+ + +++  + e+ +kr+re+  +++s+l +t+++ +
  AT5G33210.2  11 GSGGVSCQDFGNQAKKDCSHMRCRTCCKSRGFECSTHVRSTWVPATKRRERQQQLATVQPQTQLPRGESVPKRHRENLPATSSSLVCTRIPFH 103
                  57899*****************************************************99999999**********************99865 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575117No hitNo description
PfamPF051422.9E-331488IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.9E-261658IPR006510Zinc finger, lateral root primordium type 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009851Biological Processauxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MMMIRSGGSG GSGGVSCQDF GNQAKKDCSH MRCRTCCKSR GFECSTHVRS TWVPATKRRE  60
RQQQLATVQP QTQLPRGESV PKRHRENLPA TSSSLVCTRI PFHSGE
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G33210
AtGenExpressAT5G33210
Functional Description ? help Back to Top
Source Description
TAIRA member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. SRS8 is a putative pseudogene.
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM) (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G33210.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G33210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0464371e-176AB046437.1 Arabidopsis thaliana DNA, chromosome 5 centromere region, clone:F11B20.
GenBankAC0695571e-176AC069557.5 Genomic Sequence For Arabidopsis thaliana Clone T29A4 From Chromosome V, complete sequence.
GenBankCP0026881e-176CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190419.12e-73SHI-related sequence 8
RefseqNP_198306.12e-72SHI-related sequence 8
SwissprotF4KH892e-73SRS8_ARATH; Protein SHI RELATED SEQUENCE 8
TrEMBLF4KH885e-72F4KH88_ARATH; SHI-related sequence 8
STRINGAT5G33210.17e-72(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Kuusk S,Sohlberg JJ,Long JA,Fridborg I,Sundberg E
    STY1 and STY2 promote the formation of apical tissues during Arabidopsis gynoecium development.
    Development, 2002. 129(20): p. 4707-17
    [PMID:12361963]
  2. Bailey PC, et al.
    Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana.
    Plant Cell, 2003. 15(11): p. 2497-502
    [PMID:14600211]
  3. Rigola D,Fiers M,Vurro E,Aarts MG
    The heavy metal hyperaccumulator Thlaspi caerulescens expresses many species-specific genes, as identified by comparative expressed sequence tag analysis.
    New Phytol., 2006. 170(4): p. 753-65
    [PMID:16684236]
  4. Kuusk S,Sohlberg JJ,Magnus Eklund D,Sundberg E
    Functionally redundant SHI family genes regulate Arabidopsis gynoecium development in a dose-dependent manner.
    Plant J., 2006. 47(1): p. 99-111
    [PMID:16740146]