PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G38800.1

Common Name

AtbZIP43, bZIP43, K15E6.1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 165aa MW: 19263.5 Da PI: 5.6868

Description

basic leucine-zipper 43

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G38800.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	39.8	9.5e-13	72	117	5	50
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 ++++rk++NRe+ArrsR RK+ +++eL v L eN++L +l+ AT5G38800.1 72 RKQKRKISNRESARRSRMRKQRQVDELWSQVMWLRDENHQLLRKLN 117 689************************************9998876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.7E-10	68	132	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.438	70	133	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	8.84E-12	72	121	No hit	No description
Pfam	PF00170	4.8E-11	72	118	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.3E-10	72	145	No hit	No description
CDD	cd14702	3.32E-17	73	121	No hit	No description
PROSITE pattern	PS00036	0	75	90	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 165 aa Download sequence Send to blast
MQPSTNIFSL HGCPPSYLSH IPTSSPFCGQ NPNPFFSFET GVNTSQFMSL ISSNNSTSDE 60 AEENHKEIIN ERKQKRKISN RESARRSRMR KQRQVDELWS QVMWLRDENH QLLRKLNCVL 120 ESQEKVIEEN VQLKEETTEL KQMISDMQLQ NQSPFSCIRD DDDVV

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	84	91	RRSRMRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.30383	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30693299	0.0
Genevisible	249534_at	0.0
Expression Atlas	AT5G38800	-
AtGenExpress	AT5G38800	-
ATTED-II	AT5G38800	-

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269\|PubMed:26973252}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00533	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G38800.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G38800
IntAct	Search Q9FMC2

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G38800

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB009048	0.0	AB009048.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K15E6.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_198696.1	1e-119	basic leucine-zipper 43
Swissprot	Q9FMC2	1e-121	BZP43_ARATH; Basic leucine zipper 43
TrEMBL	A0A178UEN6	1e-112	A0A178UEN6_ARATH; BZIP43
STRING	AT5G38800.1	1e-119	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3112	26	67
Representative plant	OGRP3104	11	29

Link Out ? help Back to Top
Phytozome	AT5G38800.1
Entrez Gene	833871
iHOP	AT5G38800
wikigenes	AT5G38800

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Dal Bosco C, et al. Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis. Plant Cell Physiol., 2004. 45(3): p. 309-17 [PMID:15047879] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Scheible WR, et al. Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] Ehlert A, et al. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J., 2006. 46(5): p. 890-900 [PMID:16709202] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Osuna D, et al. Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings. Plant J., 2007. 49(3): p. 463-91 [PMID:17217462] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Shen H,Cao K,Wang X A conserved proline residue in the leucine zipper region of AtbZIP34 and AtbZIP61 in Arabidopsis thaliana interferes with the formation of homodimer. Biochem. Biophys. Res. Commun., 2007. 362(2): p. 425-30 [PMID:17719007] Nowak K,Gaj MD Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis. J. Plant Physiol., 2016. 193: p. 119-26 [PMID:26973252] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]