![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT5G60200.1 | ||||||||
| Common Name | DOF5.3, F15L12.9, TMO6 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 257aa MW: 28201.3 Da PI: 8.7682 | ||||||||
| Description | TARGET OF MONOPTEROS 6 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 126.1 | 1.1e-39 | 53 | 111 | 4 | 62 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
al+cprCdstntkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknk+s+
AT5G60200.1 53 LALRCPRCDSTNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKRST 111
5789****************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-31 | 48 | 108 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.1E-33 | 55 | 109 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 29.45 | 55 | 109 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 57 | 93 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0048364 | Biological Process | root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0003015 | anatomy | primary root differentiation zone | ||||
| PO:0005417 | anatomy | phloem | ||||
| PO:0006203 | anatomy | pericycle | ||||
| PO:0008011 | anatomy | embryo vascular system | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020124 | anatomy | root stele | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025257 | anatomy | primary root elongation zone | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 257 aa Download sequence Send to blast |
MDHLLQHQDV FGNYNKAREA MGLSYSSNPT PLDNDQKKPS PATAVTRPQP PELALRCPRC 60 DSTNTKFCYY NNYSLTQPRY FCKSCRRYWT KGGTLRNIPV GGGCRKNKRS TSSAARSLRT 120 TPEPASHDGK VFSAAGFNGY SNNEHIDLSL AFALLNKQHP GSSSQLGFHS ELGSSHQSDM 180 EGMFGTSQQK ENATYAFGNG SSGLGDPSRV LWGFPWQMNG ESFGMMNIGG GGGHVDQIDS 240 GREMWTNMNY INSGALM |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.29177 | 0.0 | flower| root| seed | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 42568667 | 0.0 | ||||
| Genevisible | 247625_at | 0.0 | ||||
| Expression Atlas | AT5G60200 | - | ||||
| AtGenExpress | AT5G60200 | - | ||||
| ATTED-II | AT5G60200 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: In embryos, present in cells relevant for root initiation and later in vascular tissues. At the globular stage, accumulates in cells adjacent to the hypophysis (extra-embryonic cell specified to become the founder cell of the primary root meristem) (PubMed:20220754). Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. In young seedlings, first observed in the central region of leaves primordia, and later strongly expressed at sites of midvein, first and second loops, and higher-order veins (PubMed:20563990). {ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:20563990}. | |||||
| Uniprot | TISSUE SPECIFICITY: The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). Accumulates in the stele (PubMed:20563990). {ECO:0000269|PubMed:20563990, ECO:0000269|PubMed:30626969}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a Dof-type transcription factor. | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:30626969}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT5G60200.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:30626969}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT5G60200 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK228185 | 0.0 | AK228185.1 Arabidopsis thaliana mRNA for zinc finger protein - like, complete cds, clone: RAFL14-63-H23. | |||
| GenBank | BT005866 | 0.0 | BT005866.1 Arabidopsis thaliana At5g60200 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_568920.1 | 0.0 | TARGET OF MONOPTEROS 6 | ||||
| Swissprot | Q84TE9 | 0.0 | DOF53_ARATH; Dof zinc finger protein DOF5.3 | ||||
| TrEMBL | D7MTS7 | 1e-172 | D7MTS7_ARALL; Dof-type zinc finger domain-containing protein | ||||
| STRING | AT5G60200.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6132 | 18 | 45 | Representative plant | OGRP38 | 17 | 445 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT5G60200.1 |
| Entrez Gene | 836142 |
| iHOP | AT5G60200 |
| wikigenes | AT5G60200 |




