PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G60850.1

Common Name

DOF5.4, MAE1.9, OBP4

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

Dof

Protein Properties

Length: 307aa MW: 32740.8 Da PI: 7.0459

Description

OBF binding protein 4

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G60850.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	122.1	1.9e-38	47	107	2	62
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+ AT5G60850.1 47 HHQSLKCPRCNSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 107 57899****************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-35	38	105	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	5.7E-33	49	105	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.534	51	105	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	53	89	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 307 aa Download sequence Send to blast
MQDIHDFSMN GVGGGGGGGG RFFGGGIGGG GGGDRRMRAH QNNILNHHQS LKCPRCNSLN 60 TKFCYYNNYN LSQPRHFCKN CRRYWTKGGV LRNVPVGGGC RKAKRSKTKQ VPSSSSADKP 120 TTTQDDHHVE EKSSTGSHSS SESSSLTASN STTVAAVSVT AAAEVASSVI PGFDMPNMKI 180 YGNGIEWSTL LGQGSSAGGV FSEIGGFPAV SAIETTPFGF GGKFVNQDDH LKLEGETVQQ 240 QQFGDRTAQV EFQGRSSDPN MGFEPLDWGS GGGDQTLFDL TSTVDHAYWS QSQWTSSDQD 300 QSGLYLP

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	18	25	GGRFFGGG

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.20219	0.0	flower\| inflorescence\| root\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145359501	0.0
Genevisible	247601_at	0.0
Expression Atlas	AT5G60850	-
AtGenExpress	AT5G60850	-
ATTED-II	AT5G60850	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a zinc finger protein.
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
OBP4 is a negative regulator of cell cycle progression and cell growth. [PMID: 27297966] Arabidopsis OBP4 (OBF Binding Protein 4) is a novel regulator of root growth and cell elongation and differentiation. [PMID: 27859363] Results suggest that OBF BINDING PROTEIN4 (OBP4)-mediated transcriptional repression of ROOT HAIR DEFECTIVE6-LIKE2 (RSL2) promoter to repress RSL2 contributes to the abscisic acid (ABA)-dependent inhibition of root hair growth. [PMID: 28167701]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00570	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G60850.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G60850

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB015472	0.0	AB015472.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MAE1.
GenBank	AY056413	0.0	AY056413.1 Arabidopsis thaliana AT5g60850/mae1_100 mRNA, complete cds.
GenBank	AY081709	0.0	AY081709.1 Arabidopsis thaliana AT5g60850/mae1_100 mRNA, complete cds.
GenBank	AY085856	0.0	AY085856.1 Arabidopsis thaliana clone 19080 mRNA, complete sequence.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_200893.1	0.0	OBF binding protein 4
Swissprot	Q8LDR0	0.0	DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBL	A0A178UF84	0.0	A0A178UF84_ARATH; OBP4
STRING	AT5G60850.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4482	26	56
Representative plant	OGRP38	17	445

Link Out ? help Back to Top
Phytozome	AT5G60850.1
Entrez Gene	836206
iHOP	AT5G60850
wikigenes	AT5G60850

Publications ? help Back to Top
Kang HG,Singh KB Characterization of salicylic acid-responsive, arabidopsis Dof domain proteins: overexpression of OBP3 leads to growth defects. Plant J., 2000. 21(4): p. 329-39 [PMID:10758484] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yanagisawa S The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] Park DH, et al. The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling. Plant J., 2003. 34(2): p. 161-71 [PMID:12694592] Lijavetzky D,Carbonero P,Vicente-Carbajosa J Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Coupe SA, et al. Systemic signalling of environmental cues in Arabidopsis leaves. J. Exp. Bot., 2006. 57(2): p. 329-41 [PMID:16330523] Truman W,de Zabala MT,Grant M Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance. Plant J., 2006. 46(1): p. 14-33 [PMID:16553893] Moreno-Risueno MA,Mart The family of DOF transcription factors: from green unicellular algae to vascular plants. Mol. Genet. Genomics, 2007. 277(4): p. 379-90 [PMID:17180359] Chawade A,Br Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors. BMC Genomics, 2007. 8: p. 304 [PMID:17764576] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu P,Chen H,Ying L,Cai W AtDOF5.4/OBP4, a DOF Transcription Factor Gene that Negatively Regulates Cell Cycle Progression and Cell Expansion in Arabidopsis thaliana. Sci Rep, 2016. 6: p. 27705 [PMID:27297966] Ramirez-Parra E, et al. The transcription factor OBP4 controls root growth and promotes callus formation. New Phytol., 2017. 213(4): p. 1787-1801 [PMID:27859363] Rymen B, et al. ABA Suppresses Root Hair Growth via the OBP4 Transcriptional Regulator. Plant Physiol., 2017. 173(3): p. 1750-1762 [PMID:28167701]