![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT5G62380.1 | ||||||||
| Common Name | ANAC101, MMI9.21, NAC101, VND6 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 348aa MW: 39729.8 Da PI: 5.0129 | ||||||||
| Description | NAC-domain protein 101 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 174.7 | 2.6e-54 | 8 | 136 | 2 | 129 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96
ppG+rFhPtdeelv++yLk+kv+ +++ +vik+vd+yk+ePwd+++ + ++ee+ewyfFs++dkky+tg+r+nrat sg+Wkatg+dk+++s k
AT5G62380.1 8 PPGYRFHPTDEELVDYYLKNKVAFPGMQV-DVIKDVDLYKIEPWDIQElcgRGTGEEREWYFFSHKDKKYPTGTRTNRATGSGFWKATGRDKAIYS-K 103
9****************************.99**************954555555788**************************************.9 PP
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrle 129
+elvg++ktLvfykgrap+g+k+dW+mheyrle
AT5G62380.1 104 QELVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
99*****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 7.19E-60 | 5 | 156 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 58.288 | 7 | 156 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.2E-28 | 8 | 135 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| GO:0009620 | Biological Process | response to fungus | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0009735 | Biological Process | response to cytokinin | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009741 | Biological Process | response to brassinosteroid | ||||
| GO:0010981 | Biological Process | regulation of cell wall macromolecule metabolic process | ||||
| GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
| GO:0045491 | Biological Process | xylan metabolic process | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
| GO:0071555 | Biological Process | cell wall organization | ||||
| GO:0090058 | Biological Process | metaxylem development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0009531 | Cellular Component | secondary cell wall | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000039 | anatomy | shoot axis vascular system | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0000372 | anatomy | metaxylem | ||||
| PO:0003011 | anatomy | root vascular system | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 348 aa Download sequence Send to blast |
MESLAHIPPG YRFHPTDEEL VDYYLKNKVA FPGMQVDVIK DVDLYKIEPW DIQELCGRGT 60 GEEREWYFFS HKDKKYPTGT RTNRATGSGF WKATGRDKAI YSKQELVGMR KTLVFYKGRA 120 PNGQKSDWIM HEYRLETDEN GPPHEEGWVV CRAFKKKLTT MNYNNPRTMM GSSSGQESNW 180 FTQQMDVGNG NYYHLPDLES PRMFQGSSSS SLSSLHQNDQ DPYGVVLSTI NATPTTIMQR 240 DDGHVITNDD DHMIMMNTST GDHHQSGLLV NDDHNDQVMD WQTLDKFVAS QLIMSQEEEE 300 VNKDPSDNSS NETFHHLSEE QAATMVSMNA SSSSSPCSFY SWAQNTHT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 4e-50 | 2 | 157 | 10 | 169 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 18424581 | 0.0 | ||||
| Genevisible | 247479_at | 0.0 | ||||
| Expression Atlas | AT5G62380 | - | ||||
| AtGenExpress | AT5G62380 | - | ||||
| ATTED-II | AT5G62380 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem, especially newly proliferating cells derived presumably from pericycle. {ECO:0000269|PubMed:16103214}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in root inner metaxylem vessels and in hypocotyl vessels (PubMed:18445131, PubMed:18952777). Present in root developing xylems (PubMed:16103214). Accumulates in the xylem but not in interfascicular fibers or pith cells in inflorescence stems. Absent from secondary xylem in roots (PubMed:18952777). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a NAC-domain transcription factor involved in xylem formation. Induces transdifferentiation of various cells into metaxylem vessel elements. Located in the nucleus. Expression induced in the presence of auxin, cytokinin and brassinosteroids. | |||||
| UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', and to the tracheary elements (TE) specific regulating cis-element (TERE), 5'-CTTNAAAGCNA-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20952636, PubMed:20488898). Involved in xylem formation in roots and shoots, especially regulating metaxylem vessel differentiation by promoting immature xylem vessel-specific genes expression, especially genes regulating programmed cell death (PCD) and secondary wall formation in tracheary elements (TE) (PubMed:16103214, PubMed:20952636, PubMed:20488898). Can activate MYB25, MYB46, MYB58, MYB63, MYB83, MYB103, CESA4, LBD15, LBD30, ERF115, XCP1, XCP2, NAC010/SND3, KNAT7, ASL19 and ASL20 expression (PubMed:17890373, PubMed:18952777, PubMed:19088331, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:20952636). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:20952636}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00578 | DAP | 27203113 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT5G62380.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:23023171}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Target Gene (A: Activate/R: Repress) | |||||
| ATRM | AT1G16490(A), AT1G28470(A), AT1G62990(A), AT1G79180(A), AT5G12870(A), AT5G56110(A) | |||||
| Regulation -- Hormone ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hormone | |||||
| AHD | abscisic acid, brassinosteroid, cytokinin | |||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search Q9LVA1 | |||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: Defects in metaxylem vessel formation in seedling roots. {ECO:0000269|PubMed:16103214}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT5G62380 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT026510 | 0.0 | BT026510.1 Arabidopsis thaliana At5g62380 mRNA, complete cds. | |||
| GenBank | DQ056734 | 0.0 | DQ056734.1 Arabidopsis thaliana no apical meristem family protein (At5g62380) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001318864.1 | 0.0 | NAC-domain protein 101 | ||||
| Refseq | NP_201044.1 | 0.0 | NAC-domain protein 101 | ||||
| Swissprot | Q9LVA1 | 0.0 | NC101_ARATH; NAC domain-containing protein 101 | ||||
| TrEMBL | A0A178UFI9 | 0.0 | A0A178UFI9_ARATH; VND6 | ||||
| STRING | AT5G62380.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM12248 | 17 | 32 | Representative plant | OGRP17 | 15 | 800 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT5G62380.1 |
| Entrez Gene | 836359 |
| iHOP | AT5G62380 |
| wikigenes | AT5G62380 |




