![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT5G64810.1 | ||||||||
| Common Name | ATWRKY51, MXK3.3, WRKY51 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 194aa MW: 22044 Da PI: 5.3396 | ||||||||
| Description | WRKY DNA-binding protein 51 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 88.1 | 7.7e-28 | 109 | 167 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+dDg++WrKYG+K+vk++ + r+YY+C+s+gC+vkk+ver+ +d +v++tYeg Hnhe
AT5G64810.1 109 MDDGFKWRKYGKKSVKNNINKRNYYKCSSEGCSVKKRVERDGDDAAYVITTYEGVHNHE 167
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 3.4E-30 | 96 | 168 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 7.98E-26 | 101 | 167 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 27.393 | 104 | 169 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.8E-31 | 109 | 168 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.8E-22 | 110 | 167 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0042742 | Biological Process | defense response to bacterium | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000293 | anatomy | guard cell | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 194 aa Download sequence Send to blast |
MNISQNPSPN FTYFSDENFI NPFMDNNDFS NLMFFDIDEG GNNGLIEEEI SSPTSIVSSE 60 TFTGESGGSG SATTLSKKES TNRGSKESDQ TKETGHRVAF RTRSKIDVMD DGFKWRKYGK 120 KSVKNNINKR NYYKCSSEGC SVKKRVERDG DDAAYVITTY EGVHNHESLS NVYYNEMVLS 180 YDHDNWNQHS LLRS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-23 | 99 | 167 | 7 | 75 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-23 | 99 | 167 | 7 | 75 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.26597 | 0.0 | leaf | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 186532751 | 0.0 | ||||
| Expression Atlas | AT5G64810 | - | ||||
| AtGenExpress | AT5G64810 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | member of WRKY Transcription Factor; Group II-c | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT5G64810.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:21030507}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT5G64810 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF426252 | 0.0 | AF426252.1 Arabidopsis thaliana WRKY transcription factor 51 (WRKY51) mRNA, complete cds. | |||
| GenBank | BT025755 | 0.0 | BT025755.1 Arabidopsis thaliana At5g64810 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_568995.2 | 1e-143 | WRKY DNA-binding protein 51 | ||||
| Swissprot | Q93WU9 | 1e-144 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
| TrEMBL | Q1ECH9 | 1e-141 | Q1ECH9_ARATH; At5g64810 | ||||
| STRING | AT5G64810.1 | 1e-142 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM5711 | 27 | 47 | Representative plant | OGRP14 | 17 | 875 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT5G64810.1 |
| Entrez Gene | 836602 |
| iHOP | AT5G64810 |
| wikigenes | AT5G64810 |




