PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aan009956

Organism

Artemisia annua

Taxonomic ID

35608

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia

Family

MIKC_MADS

Protein Properties

Length: 172aa MW: 20115.8 Da PI: 10.281

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Aan#S54972243	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.6	2.1e-30	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+e+s+ Aan009956 10 RIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSNKGKLFEFST 59 8***********************************************96 PP
2	K-box	106	4.4e-35	82	171	9	98
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +++a+ s++ e++kLk++ e Lqr++Rh++Ged+esLslke+q+LeqqL+++lk+iR++Kn+ll+e+i+elqkk k++qe+n++L+kk+ Aan009956 82 ATDATPRSWTLEYNKLKSRAELLQRNHRHYMGEDIESLSLKEIQNLEQQLDTGLKNIRTRKNQLLHESISELQKKGKAIQEQNTTLTKKI 171 5778889*********************************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.2E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.576	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.96E-40	2	75	No hit	No description
SuperFamily	SSF55455	1.31E-34	2	88	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.0E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-31	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	15.778	87	172	IPR002487	Transcription factor, K-box
Pfam	PF01486	9.8E-28	88	171	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 172 aa Download sequence Send to blast
MGRGKVQLRR IENKINRQVT FSKRRGGLLK KAHEISVLCD AEVALIVFSN KGKLFEFSTD 60 SCMESILERY ERYSYTERQL VATDATPRSW TLEYNKLKSR AELLQRNHRH YMGEDIESLS 120 LKEIQNLEQQ LDTGLKNIRT RKNQLLHESI SELQKKGKAI QEQNTTLTKK IX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	4e-22	1	84	1	83	MEF2 CHIMERA
6byy_B	4e-22	1	84	1	83	MEF2 CHIMERA
6byy_C	4e-22	1	84	1	83	MEF2 CHIMERA
6byy_D	4e-22	1	84	1	83	MEF2 CHIMERA
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed at an early stage of floral initiation.
Uniprot	TISSUE SPECIFICITY: Expressed in young flower primordia, later becomes localized to sepals and petals.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Is indispensable for normal development of sepals and petals in flowers. Regulates positively the B class homeotic proteins APETALA3 and PISTILLATA with the cooperation of LEAFY and UFO. Interacts with SEPALLATA3 or AP3/PI heterodimer to form complexes that could be involved in genes regulation during floral meristem development. Regulates positively AGAMOUS in cooperation with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Together with AGL24 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Represses flowering time genes AGL24, SVP and SOC1 in emerging floral meristems. {ECO:0000269\|PubMed:11283333, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:17794879, ECO:0000269\|PubMed:19656343, ECO:0000269\|Ref.8}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by TFL1 and by the C class floral homeotic protein AGAMOUS. Positively regulated by CAULIFLOWER. {ECO:0000269\|PubMed:9783581}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021977399.1	1e-120	truncated transcription factor CAULIFLOWER A-like isoform X1
Swissprot	P35631	7e-94	AP1_ARATH; Floral homeotic protein APETALA 1
TrEMBL	G5EN33	1e-120	G5EN33_9ASTR; APETALA1 like protein
TrEMBL	K9ZS89	1e-120	K9ZS89_CHRLV; AP1 protein
TrEMBL	R4WBI0	1e-120	R4WBI0_CHRMO; APETALA1 like protein
STRING	cassava4.1_029935m	2e-99	(Manihot esculenta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	3e-96	MIKC_MADS family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Furner I,Ellis L,Bakht S,Mirza B,Sheikh M CAUT lines: a novel resource for studies of cell autonomy in Arabidopsis. Plant J., 2008. 53(4): p. 645-60 [PMID:18269574] Winterhagen P,Tiyayon P,Samach A,Hegele M,Wünsche JN Isolation and characterization of FLOWERING LOCUS T subforms and APETALA1 of the subtropical fruit tree Dimocarpus longan. Plant Physiol. Biochem., 2013. 71: p. 184-90 [PMID:23954797] Lei HJ, et al. Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry. Gene, 2013. 531(2): p. 158-67 [PMID:24055423] Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Qian H, et al. The circadian clock gene regulatory module enantioselectively mediates imazethapyr-induced early flowering in Arabidopsis thaliana. J. Plant Physiol., 2014. 171(5): p. 92-8 [PMID:24484962] Maejima K, et al. Recognition of floral homeotic MADS domain transcription factors by a phytoplasmal effector, phyllogen, induces phyllody. Plant J., 2014. 78(4): p. 541-54 [PMID:24597566] Azeez A,Miskolczi P,Tylewicz S,Bhalerao RP A tree ortholog of APETALA1 mediates photoperiodic control of seasonal growth. Curr. Biol., 2014. 24(7): p. 717-24 [PMID:24656832] MacLean AM, et al. Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. PLoS Biol., 2014. 12(4): p. e1001835 [PMID:24714165] Yamaguchi N, et al. Gibberellin acts positively then negatively to control onset of flower formation in Arabidopsis. Science, 2014. 344(6184): p. 638-41 [PMID:24812402] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Zheng T, et al. Overexpression of two PsnAP1 genes from Populus simonii × P. nigra causes early flowering in transgenic tobacco and Arabidopsis. PLoS ONE, 2014. 9(10): p. e111725 [PMID:25360739] Zhao S, et al. ZmSOC1, a MADS-box transcription factor from Zea mays, promotes flowering in Arabidopsis. Int J Mol Sci, 2014. 15(11): p. 19987-20003 [PMID:25372944] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Leal Valentim F, et al. A quantitative and dynamic model of the Arabidopsis flowering time gene regulatory network. PLoS ONE, 2015. 10(2): p. e0116973 [PMID:25719734] Thoma R,Chandler JW Polarity in the early floral meristem of Arabidopsis. Plant Signal Behav, 2015. 10(4): p. e992733 [PMID:25806573] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148] Minguet EG,Segard S,Charavay C,Parcy F MORPHEUS, a Webtool for Transcription Factor Binding Analysis Using Position Weight Matrices with Dependency. PLoS ONE, 2015. 10(8): p. e0135586 [PMID:26285209] Han Y,Jiao Y APETALA1 establishes determinate floral meristem through regulating cytokinins homeostasis in Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e989039 [PMID:26359644] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Xie W, et al. Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach. Front Plant Sci, 2015. 6: p. 829 [PMID:26528302] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] McCarthy EW,Mohamed A,Litt A Functional Divergence of APETALA1 and FRUITFULL is due to Changes in both Regulation and Coding Sequence. Front Plant Sci, 2015. 6: p. 1076 [PMID:26697035] Saleh A,Alvarez-Venegas R,Liu N,Avramova Z Corrigendum to "Dynamic and stable histone H3 methylation patterns at the Arabidopsis FLC and AP1 loci" [Gene. 2008 Oct. 15; 423(1):43-47]. Gene, 2016. 585(2): p. 266-7 [PMID:27094816] Tang M,Tao YB,Xu ZF Ectopic expression of Jatropha curcas APETALA1 (JcAP1) caused early flowering in Arabidopsis, but not in Jatropha. PeerJ, 2016. 4: p. e1969 [PMID:27168978] Ye L,Wang B,Zhang W,Shan H,Kong H Gains and Losses of Cis-regulatory Elements Led to Divergence of the Arabidopsis APETALA1 and CAULIFLOWER Duplicate Genes in the Time, Space, and Level of Expression and Regulation of One Paralog by the Other. Plant Physiol., 2016. 171(2): p. 1055-69 [PMID:27208240] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Monniaux M, et al. Conservation vs divergence in LEAFY and APETALA1 functions between Arabidopsis thaliana and Cardamine hirsuta. New Phytol., 2017. 216(2): p. 549-561 [PMID:28098947] Goslin K, et al. Transcription Factor Interplay between LEAFY and APETALA1/CAULIFLOWER during Floral Initiation. Plant Physiol., 2017. 174(2): p. 1097-1109 [PMID:28385730] Sawettalake N,Bunnag S,Wang Y,Shen L,Yu H DOAP1 Promotes Flowering in the Orchid Dendrobium Chao Praya Smile. Front Plant Sci, 2017. 8: p. 400 [PMID:28386268] Kim D,Abdelaziz ME,Ntui VO,Guo X,Al-Babili S Colonization by the endophyte Piriformospora indica leads to early flowering in Arabidopsis thaliana likely by triggering gibberellin biosynthesis. Biochem. Biophys. Res. Commun., 2017. 490(4): p. 1162-1167 [PMID:28668394] Serrano-Mislata A, et al. Regulatory interplay between LEAFY, APETALA1/CAULIFLOWER and TERMINAL FLOWER1: New insights into an old relationship. Plant Signal Behav, 2017. 12(10): p. e1370164 [PMID:28873010] Zhang GZ, et al. Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis. Plant Cell Rep., 2017. 36(12): p. 1995-2006 [PMID:29027578] Shimada T, et al. The AP-1 Complex is Required for Proper Mucilage Formation in Arabidopsis Seeds. Plant Cell Physiol., 2018. 59(11): p. 2331-2338 [PMID:30099531] Monniaux M, et al. The role of APETALA1 in petal number robustness. Elife, 2019. [PMID:30334736] Vijayraghavan U,Siddiqi I,Meyerowitz E Isolation of an 800 kb contiguous DNA fragment encompassing a 3.5-cM region of chromosome 1 in Arabidopsis using YAC clones. Genome, 1995. 38(4): p. 817-23 [PMID:7672612]