PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aan010759

Organism

Artemisia annua

Taxonomic ID

35608

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia

Family

MYB

Protein Properties

Length: 149aa MW: 17270.8 Da PI: 9.6384

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Aan#S55004923	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.1	2e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++lv+ ++++G +W++ +r g++R++k+c++rw +yl Aan010759 14 KGPWTDEEDQKLVKHIEKHGHSSWRALPRLAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP
2	Myb_DNA-binding	56.8	5.2e-18	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+++ eE+e +++++ +lG++ W++Ia +++ gRt++++k++w++ Aan010759 67 RGKFSHEEEETILHLHSMLGNK-WSAIATHLP-GRTDNEIKNYWNTN 111 89******************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-25	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.667	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	3.36E-32	11	108	IPR009057	Homeodomain-like
SMART	SM00717	5.7E-15	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	2.99E-11	16	61	No hit	No description
PROSITE profile	PS51294	26.933	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-27	65	117	IPR009057	Homeodomain-like
SMART	SM00717	3.3E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	5.8E-17	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	3.79E-11	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 149 aa Download sequence Send to blast
MGRPPCCDEP SLKKGPWTDE EDQKLVKHIE KHGHSSWRAL PRLAGLNRCG KSCRLRWTNY 60 LRPDIKRGKF SHEEEETILH LHSMLGNKWS AIATHLPGRT DNEIKNYWNT NLKKKLIHMG 120 IDPMAHRPCM DIFSSIPHLM ALANLKELX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-31	10	116	3	108	B-MYB
1h8a_C	2e-31	10	116	23	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Specifically and transiently expressed in root endodermal cells overlying the early stages of lateral root primordia formation. {ECO:0000269\|PubMed:24902892, ECO:0000269\|PubMed:25482809}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010087606.1	4e-92	transcription factor MYB93
Swissprot	Q9S9Z2	8e-86	MYB93_ARATH; Transcription factor MYB93
TrEMBL	A0A2U1PQF2	1e-104	A0A2U1PQF2_ARTAN; Myb domain protein 92
STRING	XP_010087606.1	1e-91	(Morus notabilis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G34670.1	3e-88	myb domain protein 93

Publications ? help Back to Top
Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]