PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aan012912

Organism

Artemisia annua

Taxonomic ID

35608

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia

Family

Dof

Protein Properties

Length: 68aa MW: 8073.91 Da PI: 8.9896

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Aan#S55111577	PU_ref	Unigene	View CDS
PUT-183a-Artemisia_annua-71509	PU_unref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	64.3	2.1e-20	35	67	2	34
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCk 34 +++alkcprCds ntkfCyynnyslsqPr+fCk Aan012912 35 PHEALKCPRCDSLNTKFCYYNNYSLSQPRHFCK 67 57899***************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF02701	4.6E-17	37	67	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	2.0E-11	37	67	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	17.737	39	68	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 68 aa Download sequence Send to blast
MAAPGVRVME KPMQLQQHQQ QQQQQQQQQQ QPPPPHEALK CPRCDSLNTK FCYYNNYSLS 60 QPRHFCKX

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: The transcript levels of the gene accumulate in dry seeds and decay gradually during after-ripening and also upon seed imbibition. {ECO:0000269\|PubMed:22155632}.
Uniprot	TISSUE SPECIFICITY: The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE). {ECO:0000269\|PubMed:30626969}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that negatively affects seed germination and opposes TCP14 function in the regulation of a specific set of abscisic acid-related genes (PubMed:22155632). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000269\|PubMed:22155632, ECO:0000269\|PubMed:30626969}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cytokinin in procambium. {ECO:0000269\|PubMed:30626969}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019170253.1	1e-20	PREDICTED: dof zinc finger protein DOF1.4 isoform X1
Refseq	XP_019170254.1	1e-20	PREDICTED: dof zinc finger protein DOF1.4 isoform X2
Swissprot	Q9M1E6	3e-17	DOF32_ARATH; Dof zinc finger protein DOF3.2
TrEMBL	A0A142IXE2	1e-21	A0A142IXE2_CHRMO; DOF transcription factor 9 (Fragment)
STRING	XP_010678379.1	2e-18	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60850.1	4e-18	OBF binding protein 4

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] de Lucas M, et al. Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation. Plant Cell, 2016. 28(10): p. 2616-2631 [PMID:27650334] Ravindran P,Verma V,Stamm P,Kumar PP A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor. Mol Plant, 2017. 10(10): p. 1307-1320 [PMID:28917589] Miyashima S, et al. Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]