PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aan014215

Organism

Artemisia annua

Taxonomic ID

35608

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia

Family

G2-like

Protein Properties

Length: 228aa MW: 25030.9 Da PI: 8.4795

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PUT-183a-Artemisia_annua-512160993	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	108.4	3.8e-34	31	85	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kpr+rWtpeLHe+Fveav++LGGse+AtPk +l+ mkv+gLt++hvkSHLQkYR+ Aan014215 31 KPRMRWTPELHEAFVEAVNKLGGSERATPKGVLKQMKVEGLTIYHVKSHLQKYRT 85 79****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	13.404	28	88	IPR017930	Myb domain
SuperFamily	SSF46689	2.06E-18	29	85	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.5E-31	29	87	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.1E-25	31	85	IPR006447	Myb domain, plants
Pfam	PF00249	9.0E-11	33	84	IPR001005	SANT/Myb domain
Pfam	PF14379	1.1E-23	117	163	IPR025756	MYB-CC type transcription factor, LHEQLE-containing domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 228 aa Download sequence Send to blast
XRVSKGLVPA SSGDACTPMT PSSCGSGSQS KPRMRWTPEL HEAFVEAVNK LGGSERATPK 60 GVLKQMKVEG LTIYHVKSHL QKYRTARYRP EPSSEEPSER KTTVADFSSL ELKTGLEITE 120 ALRLQMEVQK RLHEQLEIQR NLQLRLEEQG RHLQMMFEKQ CKSGIDKFKA SSDVTNGTPD 180 SSAKAESPTL QANPNEPGLD PVAGPSDEGP SNSGPSDSQP TKRAKVNE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	8e-35	31	89	2	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	8e-35	31	89	2	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	8e-35	31	89	2	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	8e-35	31	89	2	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	8e-35	31	89	2	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	8e-35	31	89	2	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	8e-35	31	89	2	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	8e-35	31	89	2	60	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in phosphate starvation signaling (PubMed:11511543, PubMed:17927693, PubMed:26586833). Binds as a dimer to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:11511543, PubMed:20838596, PubMed:26586833). SPX1 is a competitive inhibitor of this DNA-binding (PubMed:25271326). PHR1 binding to its targets is low Pi-dependent (PubMed:25271326). Regulates the expression of miR399 (PubMed:20838596). Regulates the expression of IPS1 (At3g09922), a non-coding RNA that mimics the target of miR399 to block the cleavage of PHO2 under Pi-deficient conditions (PubMed:17643101). Regulates lipid remodeling and triacylglycerol accumulation during phosphorus starvation (PubMed:25680792). Required for the shoot-specific hypoxic response (PubMed:24753539). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). Contributes to the homeostasis of both sulfate and phosphate in plants under phosphate deficiency (PubMed:21261953). Required for adaptation to high light and retaining functional photosynthesis during phosphate starvation (PubMed:21910737). Involved in the coregulation of Zn and Pi homeostasis (PubMed:24420568). {ECO:0000269\|PubMed:11511543, ECO:0000269\|PubMed:17643101, ECO:0000269\|PubMed:17927693, ECO:0000269\|PubMed:20838596, ECO:0000269\|PubMed:21261953, ECO:0000269\|PubMed:21910737, ECO:0000269\|PubMed:23788639, ECO:0000269\|PubMed:24420568, ECO:0000269\|PubMed:24753539, ECO:0000269\|PubMed:25271326, ECO:0000269\|PubMed:25680792, ECO:0000269\|PubMed:26586833}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Only moderately up-regulated by Pi starvation. {ECO:0000269\|PubMed:11511543}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021975952.1	1e-118	protein PHOSPHATE STARVATION RESPONSE 1-like
Refseq	XP_021975961.1	1e-118	protein PHOSPHATE STARVATION RESPONSE 1-like
Swissprot	Q94CL7	5e-73	PHR1_ARATH; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBL	A0A2U1N8E7	1e-147	A0A2U1N8E7_ARTAN; Myb domain
STRING	XP_007162589.1	8e-86	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28610.1	2e-70	phosphate starvation response 1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Matsui K,Togami J,Mason JG,Chandler SF,Tanaka Y Enhancement of phosphate absorption by garden plants by genetic engineering: a new tool for phytoremediation. Biomed Res Int, 2013. 2013: p. 182032 [PMID:23984322] Jost R, et al. Differentiating phosphate-dependent and phosphate-independent systemic phosphate-starvation response networks in Arabidopsis thaliana through the application of phosphite. J. Exp. Bot., 2015. 66(9): p. 2501-14 [PMID:25697796] Zhou Z, et al. SPX proteins regulate Pi homeostasis and signaling in different subcellular level. Plant Signal Behav, 2015. 10(9): p. e1061163 [PMID:26224365] Bonnot C, et al. A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana. New Phytol., 2016. 209(1): p. 161-76 [PMID:26243630] Khan GA,Vogiatzaki E,Glauser G,Poirier Y Phosphate Deficiency Induces the Jasmonate Pathway and Enhances Resistance to Insect Herbivory. Plant Physiol., 2016. 171(1): p. 632-44 [PMID:27016448] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Yong-Villalobos L, et al. Phosphate starvation induces DNA methylation in the vicinity of cis-acting elements known to regulate the expression of phosphate-responsive genes. Plant Signal Behav, 2016. 11(5): p. e1173300 [PMID:27185363] Li Y,Wu H,Fan H,Zhao T,Ling HQ Characterization of the AtSPX3 Promoter Elucidates its Complex Regulation in Response to Phosphorus Deficiency. Plant Cell Physiol., 2016. 57(8): p. 1767-78 [PMID:27382128] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Yuan J, et al. Systematic characterization of novel lncRNAs responding to phosphate starvation in Arabidopsis thaliana. BMC Genomics, 2016. 17: p. 655 [PMID:27538394] Linn J, et al. Root Cell-Specific Regulators of Phosphate-Dependent Growth. Plant Physiol., 2017. 174(3): p. 1969-1989 [PMID:28465462] Aleksza D,Horváth GV,Sándor G,Szabados L Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation. Plant Physiol., 2017. 175(1): p. 555-567 [PMID:28765275] Liu Y, et al. Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1. Plant Cell, 2017. 29(9): p. 2269-2284 [PMID:28842534] Qi W,Manfield IW,Muench SP,Baker A AtSPX1 affects the AtPHR1-DNA-binding equilibrium by binding monomeric AtPHR1 in solution. Biochem. J., 2017. 474(21): p. 3675-3687 [PMID:28887383] Huang KL, et al. The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots. Plant Physiol., 2018. 178(1): p. 413-427 [PMID:30026290] Jiang M, et al. Structural basis for the Target DNA recognition and binding by the MYB domain of phosphate starvation response 1. FEBS J., 2019. [PMID:30974511]