![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aan016178 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 108aa MW: 12366.2 Da PI: 9.6003 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 57.6 | 3e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl
Aan016178 14 KGPWTPEEDIILVTYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
79******************************99************97 PP
| |||||||
| 2 | Myb_DNA-binding | 41.7 | 2.6e-13 | 67 | 108 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
rg++T E+ +v++ ++lG++ W++Ia++++ Rt++++k++w
Aan016178 67 RGNFTSHEEGMIVHLQALLGNK-WAAIASYLP-QRTDNDIKNYW 108
89********************.*********.*********** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.954 | 9 | 65 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.2E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.9E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 7.0E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 9.04E-12 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-19 | 65 | 108 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 14.606 | 66 | 108 | IPR017930 | Myb domain |
| SMART | SM00717 | 0.0017 | 66 | 108 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.0E-11 | 67 | 108 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.06E-7 | 69 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MGRPPCCDKV GIKKGPWTPE EDIILVTYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TSHEEGMIVH LQALLGNKWA AIASYLPQRT DNDIKNYW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 1e-23 | 12 | 108 | 25 | 120 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}. | |||||
| Uniprot | TISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016725886.1 | 6e-77 | PREDICTED: myb-related protein 306-like | ||||
| Refseq | XP_022743457.1 | 6e-77 | myb-related protein 306-like | ||||
| Swissprot | B3VTV7 | 4e-77 | MYB60_VITVI; Transcription factor MYB60 | ||||
| TrEMBL | A0A1Q3BPR5 | 1e-75 | A0A1Q3BPR5_CEPFO; Myb_DNA-binding domain-containing protein | ||||
| TrEMBL | A0A2U1MJF7 | 4e-76 | A0A2U1MJF7_ARTAN; Myb domain protein 60 | ||||
| STRING | Aquca_014_00947.1 | 4e-76 | (Aquilegia coerulea) | ||||
| STRING | evm.model.supercontig_73.13 | 3e-76 | (Carica papaya) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G08810.1 | 7e-79 | myb domain protein 60 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




