PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan018568
Organism
Artemisia annua
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family NAC
Protein Properties Length: 152aa    MW: 17982.4 Da    PI: 9.7651
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-50253PU_unrefplantGDBView CDS
PUT-183a-Artemisia_annua-50254PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.6e-53201471128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv +yL++k+ gk+++  ++i++v++ykvePwdLp  +++k+++ ewyfFs  dkky +g+r+nrat++gyWk+tgkd++v++ +++
  Aan018568  20 LAPGFRFHPTDEELVIYYLRRKICGKPFRY-DAISDVEVYKVEPWDLPdlSRLKTRDLEWYFFSVLDKKYGNGSRTNRATDRGYWKTTGKDRSVYH-RSQ 117
                579**************************9.99**************96448888889**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                lvg+kktLv++ grapkge+t+Wvmh+yrl
  Aan018568 118 LVGMKKTLVYHIGRAPKGERTNWVMHDYRL 147
                ****************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-5815150IPR003441NAC domain
PROSITE profilePS5100553.21120152IPR003441NAC domain
PfamPF023652.4E-2722147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MAIVIDSNQP TQTQSQSQSL APGFRFHPTD EELVIYYLRR KICGKPFRYD AISDVEVYKV  60
EPWDLPDLSR LKTRDLEWYF FSVLDKKYGN GSRTNRATDR GYWKTTGKDR SVYHRSQLVG  120
MKKTLVYHIG RAPKGERTNW VMHDYRLIDQ EL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-471914919147NAC domain-containing protein 19
3swm_B2e-471914919147NAC domain-containing protein 19
3swm_C2e-471914919147NAC domain-containing protein 19
3swm_D2e-471914919147NAC domain-containing protein 19
3swp_A2e-471914919147NAC domain-containing protein 19
3swp_B2e-471914919147NAC domain-containing protein 19
3swp_C2e-471914919147NAC domain-containing protein 19
3swp_D2e-471914919147NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the anthers and the upper parts of the stamen filaments after stage 7 to 9 of flower budding. In stage 10 flower buds, expressed in the anthers and pollen grains. Weakly expressed in mature flowers at stage 12. {ECO:0000269|PubMed:24323506}.
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex and stems. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (Ref.6, PubMed:24323506, PubMed:25219309). Promotes reactive oxygen species (ROS) production during drought-induced leaf senescence. In response to abscisic acid (ABA)-mediated drought stress signals, binds directly to the promoters of RBOHC and RBOHE genes, encoding ROS biosynthetic enzymes, resulting in ROS accumulation and triggering leaf senescence via programmed cell death (PCD). ROS-induced leaf senescence sustains plant survival under drought conditions (PubMed:22313226). Involved in heat stress response. Modulates PCD through a ROS-mediated positive feedback control under heat stress conditions. This may provide an adaptation strategy for plant survival under extreme heat stress conditions (PubMed:25219309). Acts as repressor in preventing anther dehiscence during stamen development by suppressing genes that participate in jasmonic acid (JA) biosynthesis, such as DAD1, AOS, AOC3, OPR3 and 4CLL5/OPCL1 (PubMed:24323506). {ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:24323506, ECO:0000269|PubMed:25219309, ECO:0000269|Ref.6}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) (PubMed:22313226, PubMed:25219309). Induced by heat shock (PubMed:25219309). Induced by cold, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:25219309}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023751379.15e-93NAC domain-containing protein 53-like
SwissprotQ949N04e-75NAC53_ARATH; NAC domain-containing protein 53
TrEMBLA0A2U1LX261e-101A0A2U1LX26_ARTAN; AMP-dependent synthetase/ligase, AMP-binding enzyme C-terminal domain protein
TrEMBLA0A2U1NSP71e-105A0A2U1NSP7_ARTAN; NAC domain containing protein 53
STRINGMigut.F01913.1.p3e-78(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.12e-78NAC domain containing protein 53
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  4. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  5. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]