PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aan019442

Organism

Artemisia annua

Taxonomic ID

35608

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia

Family

HSF

Protein Properties

Length: 75aa MW: 8270.16 Da PI: 4.2858

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Aan#S56475660	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	49.6	1.1e-15	30	74	2	46
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHST CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFk 46 Fl k+y++++d+++++++sws+ +n+fvv+d+ efak++LpkyFk Aan019442 30 FLVKTYDMVDDPSTDKVVSWSAANNTFVVWDPPEFAKDLLPKYFK 74 9******************999******************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.3E-17	22	74	IPR011991	Winged helix-turn-helix DNA-binding domain
SuperFamily	SSF46785	5.51E-15	25	74	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	2.6E-5	26	75	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	6.1E-12	30	74	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	4.2E-8	30	53	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	4.2E-8	68	75	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MEPQQPPPRS NDGAAIPPPP MPAANAPPPF LVKTYDMVDD PSTDKVVSWS AANNTFVVWD 60 PPEFAKDLLP KYFKX

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015160909.1	4e-29	PREDICTED: heat shock factor protein HSF8 isoform X1
Refseq	XP_015160911.1	4e-29	PREDICTED: heat shock factor protein HSF8 isoform X2
Swissprot	Q40152	6e-23	HSF8_SOLLC; Heat shock factor protein HSF8
TrEMBL	A0A314L0P4	5e-27	A0A314L0P4_NICAT; Heat shock factor protein hsf8
TrEMBL	S8CTT4	2e-27	S8CTT4_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009781208.1	1e-27	(Nicotiana sylvestris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17750.1	2e-21	heat shock factor 1

Publications ? help Back to Top
Zhu B, et al. Identification and characterization of a novel heat shock transcription factor gene, GmHsfA1, in soybeans (Glycine max). J. Plant Res., 2006. 119(3): p. 247-56 [PMID:16570125] Cai SY, et al. HsfA1a upregulates melatonin biosynthesis to confer cadmium tolerance in tomato plants. J. Pineal Res., 2017. [PMID:28095626] Zhou J, et al. Heat Shock Factor HsfA1a Is Essential for R Gene-Mediated Nematode Resistance and Triggers H2O2 Production1. Plant Physiol., 2018. 176(3): p. 2456-2471 [PMID:29339397]