![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aan019961 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 130aa MW: 15033 Da PI: 9.5247 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.8 | 1.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +lv +++q G+g+W+++++ g+ R+ k+c++rw +yl
Aan019961 14 KGPWTPEEDIILVSYIQQNGPGNWRSVPSNTGLLRCSKSCRLRWTNYL 61
79******************************99************97 PP
| |||||||
| 2 | Myb_DNA-binding | 54.6 | 2.5e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T++E+++++++ ++lG++ W++Ia++++ Rt++++k++w+++l
Aan019961 67 RGNFTEQEEKKIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
89********************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 6.5E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 17.868 | 9 | 61 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 7.99E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.3E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.0E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.54E-10 | 16 | 61 | No hit | No description |
| PROSITE profile | PS51294 | 25.237 | 62 | 116 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 6.4E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.7E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.7E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.82E-11 | 69 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MGRPPCCDKI DVKKGPWTPE EDIILVSYIQ QNGPGNWRSV PSNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TEQEEKKIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLEKQN 120 GDSDQENDHG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 1e-26 | 11 | 116 | 24 | 128 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, leaves and weakly in seed pods. {ECO:0000269|PubMed:1840903}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaves, flowers, guard cells and lateral root primordia. {ECO:0000269|PubMed:19625633}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725). {ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:20149112, ECO:0000269|PubMed:21398568, ECO:0000269|PubMed:23404903, ECO:0000269|PubMed:25616734, ECO:0000269|PubMed:25869652, ECO:0000269|PubMed:25912720, ECO:0000269|PubMed:26725725, ECO:0000269|PubMed:27577115}. | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA) (PubMed:19625633). Induced by infection with the cauliflower mosaic virus (CaMV) (PubMed:10226370). Induced by cold stress (PubMed:25912720). {ECO:0000269|PubMed:10226370, ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:25912720}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022017190.1 | 3e-85 | myb-related protein 306-like | ||||
| Swissprot | P81392 | 1e-79 | MYB06_ANTMA; Myb-related protein 306 | ||||
| Swissprot | Q24JK1 | 1e-79 | MYB96_ARATH; Transcription factor MYB96 | ||||
| TrEMBL | A0A2U1PNN4 | 2e-90 | A0A2U1PNN4_ARTAN; Homeodomain-like protein | ||||
| STRING | Gorai.008G192900.1 | 3e-81 | (Gossypium raimondii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62470.2 | 6e-82 | myb domain protein 96 | ||||




