![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Achn025721 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 121aa MW: 13792.4 Da PI: 5.1215 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 38 | 3.7e-12 | 1 | 54 | 10 | 63 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
+q+NRe+ArrsR RK+ + L+ + L++eN++ +l+ ++++ ++++e+
Achn025721 1 MQSNRESARRSRMRKQTHLNDLTAQISRLKEENDQIHTNLSITSQHYLNVEAEN 54
79***********************************99999999988887776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 5.8E-8 | 1 | 56 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 8.921 | 1 | 57 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 3.6E-8 | 1 | 46 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 8.44E-10 | 1 | 49 | No hit | No description |
| CDD | cd14702 | 1.04E-16 | 1 | 47 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 2.0E-9 | 3 | 71 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 121 aa Download sequence Send to blast |
MQSNRESARR SRMRKQTHLN DLTAQISRLK EENDQIHTNL SITSQHYLNV EAENSVLRAQ 60 MGELSQRLDA LNDILNYLDA SKGVFGSGVF EAIPESYMND SWNSMYFNQP IMASADLFLY 120 * |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 8 | 15 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028090424.1 | 7e-56 | bZIP transcription factor 11-like | ||||
| Refseq | XP_028098109.1 | 7e-56 | bZIP transcription factor 11-like | ||||
| Swissprot | C0Z2L5 | 4e-36 | BZP44_ARATH; bZIP transcription factor 44 | ||||
| TrEMBL | A0A2R6R046 | 6e-83 | A0A2R6R046_ACTCH; BZIP transcription factor | ||||
| STRING | POPTR_0005s25290.1 | 1e-46 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA537 | 24 | 123 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G75390.1 | 2e-38 | basic leucine-zipper 44 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




