![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Achn087751 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 101aa MW: 11006.1 Da PI: 10.878 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 88.3 | 4.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr g++KKAeEL vLCdaeva+iifs tgkl+ey+s
Achn087751 9 KKIDNITARQVTFSKRRRGLFKKAEELAVLCDAEVALIIFSATGKLFEYAS 59
68***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.801 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.8E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 5.1E-28 | 3 | 73 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MAREKIKIKK IDNITARQVT FSKRRRGLFK KAEELAVLCD AEVALIIFSA TGKLFEYASS 60 RGSLTLAFMF KNSSVRVKVT EVSIATSLTL LLSKGVFGCG * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 4e-19 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 4e-19 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 4e-19 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 4e-19 | 1 | 60 | 1 | 60 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF838217 | 7e-97 | JF838217.1 Actinidia chinensis SVP2 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011016930.1 | 4e-33 | PREDICTED: MADS-box protein JOINTLESS | ||||
| Refseq | XP_021284389.1 | 5e-33 | MADS-box protein SVP | ||||
| Swissprot | O82794 | 2e-32 | AGL24_ARATH; MADS-box protein AGL24 | ||||
| TrEMBL | A0A0B4RY01 | 8e-33 | A0A0B4RY01_ACTER; SVP3 | ||||
| TrEMBL | A0A2R6Q0C0 | 9e-33 | A0A2R6Q0C0_ACTCH; MADS-box protein like | ||||
| TrEMBL | A0A2R6RNI2 | 1e-32 | A0A2R6RNI2_ACTCH; MADS-box protein like | ||||
| TrEMBL | H6BF95 | 9e-33 | H6BF95_ACTDE; SVP3 | ||||
| TrEMBL | H6BF98 | 1e-32 | H6BF98_ACTCH; SVP2 | ||||
| TrEMBL | H6BF99 | 9e-33 | H6BF99_ACTCH; SVP3 | ||||
| STRING | EOY15444 | 2e-32 | (Theobroma cacao) | ||||
| STRING | POPTR_0002s10570.1 | 7e-33 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G24540.1 | 9e-35 | AGAMOUS-like 24 | ||||




