PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn121201

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

M-type_MADS

Protein Properties

Length: 94aa MW: 10531.1 Da PI: 9.5946

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn121201	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.3	3.5e-32	23	73	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey++ Achn121201 23 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYAN 73 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.824	15	75	IPR002100	Transcription factor, MADS-box
SMART	SM00432	9.4E-42	15	74	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.1E-30	15	80	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.45E-40	16	83	No hit	No description
PRINTS	PR00404	1.1E-33	17	37	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	17	71	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.7E-27	24	71	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-33	37	52	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-33	52	73	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MAFPNQESEG SSRKMGRGKI EIKRIENTTN RQVTFCKRRN GLLKKAYELS VLCDAEVALI 60 VFSTRGRLYE YANNRYSDGM QSMEAVVAVT SLC*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
1tqe_R	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
1tqe_S	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
6c9l_A	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
6c9l_B	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
6c9l_C	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
6c9l_D	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
6c9l_E	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
6c9l_F	1e-21	15	73	1	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269\|PubMed:27776173}.
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB639032	2e-60	AB639032.1 Rhododendron kaempferi RkAG1-2 mRNA for Agamous like protein, complete cds.
GenBank	AB754499	2e-60	AB754499.1 Rhododendron macrosepalum RmAG1-1 mRNA for AGAMOUS like protein, complete cds.
GenBank	AB754500	2e-60	AB754500.1 Rhododendron macrosepalum RmAG1-2 mRNA for AGAMOUS like-protein, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007146364.1	4e-43	hypothetical protein PHAVU_006G034400g
Swissprot	P29381	3e-38	AGL1_ARATH; Agamous-like MADS-box protein AGL1
Swissprot	Q40872	2e-38	AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBL	A0A2R6QZ11	2e-46	A0A2R6QZ11_ACTCH; Floral homeotic protein like (Fragment)
STRING	XP_007146364.1	1e-42	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.2	1e-42	MIKC_MADS family protein

Publications ? help Back to Top
Matalon O, et al. Dephosphorylation of the adaptor LAT and phospholipase C-γ by SHP-1 inhibits natural killer cell cytotoxicity. Sci Signal, 2016. 9(429): p. ra54 [PMID:27221712] Ehlers K, et al. The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana. PLoS ONE, 2016. 11(10): p. e0165075 [PMID:27776173]