PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn138411

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

bHLH

Protein Properties

Length: 88aa MW: 9804.13 Da PI: 5.105

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn138411	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	31.8	2.6e-10	15	55	14	54
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+iN+ ++L+el+P++ +s K+s a L+++++YIk L Achn138411 15 DQINDLVSKLQELIPELRPRRSDKVSSAKLLQETCNYIKTL 55 79************779******************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	10.131	1	55	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	1.05E-10	15	73	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	2.6E-10	15	69	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	8.2E-8	15	55	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009742	Biological Process	brassinosteroid mediated signaling pathway
GO:0010086	Biological Process	embryonic root morphogenesis
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MDPRQSAGVS RITDDQINDL VSKLQELIPE LRPRRSDKVS SAKLLQETCN YIKTLHREVD 60 DLSERLSELL ATSDTAQAAV IRSLLLQ*

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. May play a role in the regulation of light signaling and possibly auxin signaling. {ECO:0000269\|PubMed:16527868, ECO:0000269\|PubMed:20023194, ECO:0000269\|PubMed:20220754, ECO:0000269\|PubMed:22339648}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Not induced by exogenous gibberellin. {ECO:0000269\|PubMed:16527868}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022736077.1	3e-42	transcription factor PRE3-like
Swissprot	Q9CA64	2e-35	PRE3_ARATH; Transcription factor PRE3
TrEMBL	A0A2R6PRX8	2e-51	A0A2R6PRX8_ACTCH; Transcription factor like
STRING	XP_008453188.1	6e-40	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA353	24	161

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74500.1	8e-38	activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1

Publications ? help Back to Top
Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature. Differentiation, 2010. 80(1): p. 1-8 [PMID:20219281] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Lu KJ,De Rybel B,van Mourik H,Weijers D Regulation of intercellular TARGET OF MONOPTEROS 7 protein transport in the Arabidopsis root. Development, 2018. [PMID:29358212] Baesso B, et al. Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana. Plant Biol (Stuttg), 2018. 20(3): p. 426-432 [PMID:29450949]