![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Achn143731 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 155aa MW: 17846.6 Da PI: 8.9045 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 95.6 | 2.1e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+
Achn143731 9 KRIENKINRQVTFSKRRGGLLKKANEISVLCDAEVALIVFSHKGKLFEYST 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 21.6 | 8.8e-09 | 88 | 118 | 70 | 100 |
K-box 70 nellleqieelqkkekelqeenkaLrkklee 100
n+l++e+i+elqkkek+++e+n++L +k++e
Achn143731 88 NQLMYESISELQKKEKAIKEQNNMLANKIKE 118
89**************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.763 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.97E-33 | 2 | 81 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.10E-41 | 2 | 76 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.5E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.5E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.5E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 155 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRGGLLK KANEISVLCD AEVALIVFSH KGKLFEYSTD 60 ACMEKILERY ERYSYAERDL AHDIQTPNQL MYESISELQK KEKAIKEQNN MLANKIKEME 120 NVMTRAEQCP WEQQNHVPSP SSLLPHPLPC LNIG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 4e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 4e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 4e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 4e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 4e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 4e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 4e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 4e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold shock (e.g. from 22/17 to 16/12 degrees Celsius in light/night respectively). {ECO:0000269|PubMed:18332227}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF181664 | 8e-79 | AF181664.1 Actinidia deliciosa squamosa/apetala1 homolog mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024018304.1 | 2e-64 | truncated transcription factor CAULIFLOWER A isoform X2 | ||||
| Swissprot | B4YPW6 | 3e-63 | AP1A_BRAOA; Floral homeotic protein APETALA 1 A | ||||
| Swissprot | Q39371 | 3e-63 | 3AP1_BRAOL; Floral homeotic protein APETALA 1 | ||||
| Swissprot | Q8GTF5 | 3e-63 | AP1A_BRAOB; Floral homeotic protein APETALA 1 A | ||||
| Swissprot | Q96356 | 3e-63 | 2AP1_BRAOT; Floral homeotic protein APETALA 1-2 | ||||
| TrEMBL | A0A2R6QQV6 | 5e-83 | A0A2R6QQV6_ACTCH; Floral homeotic protein APETALA 1 A like | ||||
| STRING | Solyc03g114830.2.1 | 1e-62 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA499 | 23 | 97 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69120.1 | 7e-60 | MIKC_MADS family protein | ||||




