![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Achn167511 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 68aa MW: 7461.64 Da PI: 8.0478 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 25.5 | 3.1e-08 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
rg+WT+ Ed+ l++++k +G g W+ ++
Achn167511 14 RGAWTAVEDKVLIEYIKVHGEGKWRNLPKL 43
89**********************988876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-11 | 5 | 48 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 5.1E-8 | 8 | 48 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 6.992 | 9 | 49 | IPR017877 | Myb-like domain |
| Pfam | PF00249 | 4.8E-6 | 14 | 43 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.20E-5 | 16 | 49 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
MGRSRCCPKE GLNRGAWTAV EDKVLIEYIK VHGEGKWRNL PKLAVCYRTL QVEGDGGQLM 60 EVATDAI* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010107990.1 | 4e-22 | myb-related protein Zm38 | ||||
| Swissprot | Q9M0J5 | 2e-14 | MYB41_ARATH; Transcription factor MYB41 | ||||
| TrEMBL | W9S6E4 | 1e-20 | W9S6E4_9ROSA; Anthocyanin regulatory C1 protein | ||||
| STRING | XP_010107990.1 | 2e-21 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA15484 | 7 | 7 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28110.1 | 9e-17 | myb domain protein 41 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




