PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn229321

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

bZIP

Protein Properties

Length: 146aa MW: 16171.6 Da PI: 5.9335

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn229321	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	50.4	5e-16	25	81	6	62
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 + +r+++NRe+ArrsR RK++ +e L+ v +Le+e k + +++++ + ++ l s+ Achn229321 25 KWKRMISNRESARRSRMRKQQHVEGLTGQVTQLENEKKIMEDKINSVSSMYIGLVSQ 81 669*******************************************99998776666 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.3E-18	20	84	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.979	22	72	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	8.3E-14	22	72	No hit	No description
Pfam	PF00170	3.8E-13	24	82	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.46E-13	24	79	No hit	No description
CDD	cd14702	8.63E-18	27	75	No hit	No description
PROSITE pattern	PS00036	0	27	42	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 146 aa Download sequence Send to blast
MASTKQAVSA GSDGNPCYAG VDERKWKRMI SNRESARRSR MRKQQHVEGL TGQVTQLENE 60 KKIMEDKINS VSSMYIGLVS QNNVLRAQLA ELTDRLISLN SVLQIAEEVS GLAMDIPEIP 120 EMMLEPWQLP CPMQPVSASA SMFQC*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	36	43	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:16810321, ECO:0000269\|PubMed:19531597, ECO:0000269\|PubMed:21278122, ECO:0000269\|PubMed:25108460}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:16810321, ECO:0000269\|PubMed:21278122}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028117805.1	2e-74	bZIP transcription factor 53-like
Swissprot	Q9LZP8	3e-56	BZP53_ARATH; bZIP transcription factor 53
TrEMBL	A0A2R6QUE9	1e-101	A0A2R6QUE9_ACTCH; BZIP transcription factor
STRING	Migut.D00084.1.p	5e-58	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2810	23	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G62420.1	1e-58	basic region/leucine zipper motif 53

Publications ? help Back to Top
Restovic F,Espinoza-Corral R,Gómez I,Vicente-Carbajosa J,Jordana X An active Mitochondrial Complex II Present in Mature Seeds Contains an Embryo-Specific Iron-Sulfur Subunit Regulated by ABA and bZIP53 and Is Involved in Germination and Seedling Establishment. Front Plant Sci, 2017. 8: p. 277 [PMID:28293251] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Jain P, et al. A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation. Sci Rep, 2017. 7(1): p. 14343 [PMID:29084982] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]