PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn235371

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

M-type_MADS

Protein Properties

Length: 75aa MW: 8557.99 Da PI: 10.2338

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn235371	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	82.7	2.4e-26	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+k rqvtfskRr g++KKA ELS+LC++e+a+ ifs +g+lye+++ Achn235371 9 KRIEDKNSRQVTFSKRRSGLIKKARELSILCETEIALFIFSARGRLYEFIT 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF55455	1.26E-27	1	70	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.9E-34	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	30.515	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.87E-33	2	69	No hit	No description
PRINTS	PR00404	7.4E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.3E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MGRGKVELKR IEDKNSRQVT FSKRRSGLIK KARELSILCE TEIALFIFSA RGRLYEFITG 60 DRYQVLSDYA CPVV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
1tqe_R	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
1tqe_S	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
6c9l_A	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
6c9l_B	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
6c9l_C	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
6c9l_D	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
6c9l_E	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
6c9l_F	2e-19	1	70	1	70	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269\|PubMed:10318690, ECO:0000269\|PubMed:10662856, ECO:0000269\|PubMed:12226488, ECO:0000269\|PubMed:12743119, ECO:0000269\|PubMed:14615187, ECO:0000269\|PubMed:15084721, ECO:0000269\|PubMed:15686521, ECO:0000269\|PubMed:17521410, ECO:0000269\|PubMed:18305206, ECO:0000269\|PubMed:19269998, ECO:0000269\|PubMed:19767455, ECO:0000269\|PubMed:8953767}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269\|PubMed:15686521}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028107381.1	4e-31	truncated transcription factor CAULIFLOWER A-like
Swissprot	Q38847	2e-25	AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBL	A0A2R6RJZ2	4e-32	A0A2R6RJZ2_ACTCH; Agamous-like MADS-box protein
STRING	XP_008231097.1	1e-27	(Prunus mume)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13790.1	9e-28	AGAMOUS-like 15

Publications ? help Back to Top
Zheng Q,Zheng Y,Perry SE Decreased GmAGL15 expression and reduced ethylene synthesis may contribute to reduced somatic embryogenesis in a poorly embryogenic cultivar of Glycine max. Plant Signal Behav, 2014. [PMID:23838957] Perry SE,Zheng Q,Zheng Y Transcriptome analysis indicates that GmAGAMOUS-Like 15 may enhance somatic embryogenesis by promoting a dedifferentiated state. Plant Signal Behav, 2016. 11(7): p. e1197463 [PMID:27302197] Cosio C, et al. The class III peroxidase PRX17 is a direct target of the MADS-box transcription factor AGAMOUS-LIKE15 (AGL15) and participates in lignified tissue formation. New Phytol., 2017. 213(1): p. 250-263 [PMID:27513887] Zheng Q,Zheng Y,Ji H,Burnie W,Perry SE Gene Regulation by the AGL15 Transcription Factor Reveals Hormone Interactions in Somatic Embryogenesis. Plant Physiol., 2016. 172(4): p. 2374-2387 [PMID:27794101] Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis. Plant Cell, 2018. 30(3): p. 600-619 [PMID:29475938]