PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn243501

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

M-type_MADS

Protein Properties

Length: 158aa MW: 17922.2 Da PI: 9.1153

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn243501	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.7	1.2e-31	23	72	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+ Achn243501 23 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYA 72 79***********************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	9.4E-42	15	74	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.964	15	75	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.52E-47	16	89	No hit	No description
SuperFamily	SSF55455	2.22E-33	16	88	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-33	17	37	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	17	71	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.9E-27	24	71	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-33	37	52	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-33	52	73	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MAFPNQESEG SSRKMGRGKI EIKRIENTTN RQVTFCKRRN GLLKKAYELS VLCDAEVALI 60 VFSTRGRLYE YANNSVRSTI DRYKKACSDV LNTGSVSQSN TQIAENERAQ QQMNLMPGAE 120 YQDMPSQPYD ARIFLPVNLL EPNHQYSRQD QTALHLV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-21	15	105	1	86	MEF2C
5f28_B	2e-21	15	105	1	86	MEF2C
5f28_C	2e-21	15	105	1	86	MEF2C
5f28_D	2e-21	15	105	1	86	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269\|PubMed:27776173}.
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB754499	1e-87	AB754499.1 Rhododendron macrosepalum RmAG1-1 mRNA for AGAMOUS like protein, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028062219.1	2e-60	floral homeotic protein AGAMOUS-like isoform X1
Refseq	XP_028062220.1	1e-60	floral homeotic protein AGAMOUS-like isoform X2
Swissprot	P29381	5e-53	AGL1_ARATH; Agamous-like MADS-box protein AGL1
Swissprot	Q43585	5e-53	AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBL	A0A2R6QZ11	1e-67	A0A2R6QZ11_ACTCH; Floral homeotic protein like (Fragment)
STRING	XP_008229393.1	1e-57	(Prunus mume)
STRING	EMJ18463	1e-57	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.1	2e-55	MIKC_MADS family protein

Publications ? help Back to Top
Matalon O, et al. Dephosphorylation of the adaptor LAT and phospholipase C-γ by SHP-1 inhibits natural killer cell cytotoxicity. Sci Signal, 2016. 9(429): p. ra54 [PMID:27221712] Ehlers K, et al. The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana. PLoS ONE, 2016. 11(10): p. e0165075 [PMID:27776173] Cheung AY,Zhan XY,Wang H,Wu HM Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein. Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8 [PMID:8632979]