![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Achn244541 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 102aa MW: 11173.7 Da PI: 10.2645 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 61.5 | 1.5e-19 | 5 | 45 | 19 | 59 |
SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 19 efprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
rsYY+Ct agC+v+k+ver++ dpk v++tYeg+Hnh+
Achn244541 5 SICRSYYKCTNAGCNVRKQVERASADPKSVVTTYEGKHNHD 45
678*************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 3.1E-13 | 1 | 46 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.4E-15 | 5 | 47 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 3.2E-18 | 5 | 47 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.7E-14 | 6 | 45 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 22.114 | 8 | 47 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MLLNSICRSY YKCTNAGCNV RKQVERASAD PKSVVTTYEG KHNHDVPAAR KSSQNTANSN 60 TSQVKSQKVV AKKPALLAEI GFRNNDQRPV LVQLKEEQIT A* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 6e-20 | 4 | 48 | 34 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 6e-20 | 4 | 48 | 34 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028091443.1 | 9e-45 | probable WRKY transcription factor 3 | ||||
| Swissprot | Q9ZQ70 | 1e-21 | WRKY3_ARATH; Probable WRKY transcription factor 3 | ||||
| TrEMBL | A0A2R6RUG1 | 5e-58 | A0A2R6RUG1_ACTCH; WRKY transcription factor 4 | ||||
| STRING | POPTR_0017s12420.1 | 2e-43 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA17453 | 3 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03340.1 | 4e-21 | WRKY DNA-binding protein 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




