![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Achn249161 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 83aa MW: 9602.3 Da PI: 9.4086 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 103.5 | 1.8e-32 | 10 | 82 | 1 | 73 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPv 73
+CaaCk+lrr+C+++C+lapyfp+++p kf +h+ FGasn++k+l++lpe++reda++s+vyeA+ar +dPv
Achn249161 10 PCAACKILRRRCVEKCILAPYFPHTDPLKFTLAHRHFGASNIIKFLQELPESHREDAVKSMVYEANARFKDPV 82
7***********************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 22.583 | 9 | 82 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.5E-31 | 10 | 82 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MNMNMIERRP CAACKILRRR CVEKCILAPY FPHTDPLKFT LAHRHFGASN IIKFLQELPE 60 SHREDAVKSM VYEANARFKD PV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 5e-28 | 10 | 82 | 11 | 83 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 5e-28 | 10 | 82 | 11 | 83 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019427570.1 | 8e-42 | PREDICTED: LOB domain-containing protein 1-like | ||||
| Swissprot | Q9SK08 | 3e-40 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
| TrEMBL | A0A2R6RS39 | 5e-46 | A0A2R6RS39_ACTCH; LOB domain-containing protein | ||||
| STRING | GLYMA10G35760.1 | 2e-40 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA43 | 24 | 669 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G28500.1 | 1e-42 | LOB domain-containing protein 11 | ||||




