![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Achn271971 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 147aa MW: 16394.3 Da PI: 6.5287 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 168.6 | 7.3e-53 | 16 | 108 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
+eqdr+lPianv+rimk++lP nak+sk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dy++p+k yl++yrel
Achn271971 16 KEQDRLLPIANVGRIMKQILPPNAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALGSLGFDDYAKPMKSYLNRYRELG 108
89*****************************************************************************************84 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 8.5E-52 | 12 | 130 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.59E-40 | 18 | 135 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.1E-28 | 21 | 85 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.1E-18 | 49 | 67 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 52 | 68 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.1E-18 | 68 | 86 | No hit | No description |
| PRINTS | PR00615 | 3.1E-18 | 87 | 105 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 147 aa Download sequence Send to blast |
MVDNTGSNSS EDGVKKEQDR LLPIANVGRI MKQILPPNAK VSKEAKETMQ ECVSEFISFV 60 TGEASDKCHK EKRKTVNGDD ICWALGSLGF DDYAKPMKSY LNRYRELGER DSQNKASNYN 120 EDSKDEPQNH RGEPSIFKFS VINGGK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-44 | 16 | 106 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-44 | 16 | 106 | 2 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010652046.1 | 4e-72 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | O82248 | 6e-56 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A2R6P5Y1 | 1e-105 | A0A2R6P5Y1_ACTCH; Nuclear transcription factor Y subunit B-5 like | ||||
| STRING | VIT_07s0104g01640.t01 | 2e-71 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 2e-58 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




