PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn322771

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

HSF

Protein Properties

Length: 108aa MW: 11868.5 Da PI: 4.567

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn322771	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	84.8	1.2e-26	26	84	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl k+y++++d+++++++sws ++nsf+v+d+ efa+++LpkyFkh+nf+SFvRQLn+Y Achn322771 26 FLVKTYDMVDDPSTDKVVSWSPTNNSFIVWDPPEFARDLLPKYFKHNNFSSFVRQLNTY 84 9******************999********************************* PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.3E-29	18	84	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.9E-29	22	107	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	1.77E-25	24	84	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	6.8E-23	26	84	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.8E-17	26	49	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.8E-17	64	76	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.8E-17	77	89	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 108 aa Download sequence Send to blast
MDTVNGGATP APAPAPMPNA NAPPPFLVKT YDMVDDPSTD KVVSWSPTNN SFIVWDPPEF 60 ARDLLPKYFK HNNFSSFVRQ LNTYPVALAT MHFILPWESI LGFSALD*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	5e-22	18	84	18	87	Heat shock factor protein 1
5d5v_B	5e-22	18	84	18	87	Heat shock factor protein 1
5d5v_D	5e-22	18	84	18	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:7948881}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019267090.1	2e-45	PREDICTED: heat shock factor protein HSF8-like
Swissprot	P41151	2e-38	HFA1A_ARATH; Heat stress transcription factor A-1a
TrEMBL	A0A2R6QPE7	1e-52	A0A2R6QPE7_ACTCH; Heat shock factor protein
STRING	XP_009781208.1	7e-43	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA572	24	113

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17750.1	2e-34	heat shock factor 1

Publications ? help Back to Top
Hsu SF,Jinn TL AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs. Plant Signal Behav, 2010. 5(8): p. 1042-4 [PMID:20657173] Liu HC,Charng YY Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] Li S, et al. HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis. Plant Cell, 2014. 26(4): p. 1764-1780 [PMID:24728648] Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors. J. Exp. Bot., 2016. 67(21): p. 6139-6148 [PMID:27811081]