PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn347011

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

YABBY

Protein Properties

Length: 70aa MW: 7843.74 Da PI: 9.8416

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn347011	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	77.4	4.7e-24	7	43	134	170
YABBY 134 keeiqrikasnPdishreafsaaaknWahfPkihfgl 170 +eeiqrika+nP+ishreafs+aaknWahfP+ihfgl Achn347011 7 REEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGL 43 79*********************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	3.6E-22	7	43	IPR006780	YABBY protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 70 aa Download sequence Send to blast
MPFANKREEI QRIKANNPEI SHREAFSTAA KNWAHFPHIH FGLKLDGNKK AKLDQSFAGN 60 GDQESTGFY*

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021635119.1	3e-34	putative axial regulator YABBY 2 isoform X3
Swissprot	Q9XFB0	4e-30	YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBL	A0A2R6PQX3	1e-38	A0A2R6PQX3_ACTCH; Axial regulator YABBY
STRING	EOY33226	8e-32	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA381	24	163

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08465.1	2e-32	YABBY family protein

Publications ? help Back to Top
Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148]