![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aco001114.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 110aa MW: 11775.4 Da PI: 7.5903 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 103.2 | 1.8e-32 | 43 | 100 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
vrY eC+kNhAas+GghavDGC+Efm+ geegt+ al+CaACgCHR+FHRr +e+e
Aco001114.1 43 VVRYGECQKNHAASIGGHAVDGCREFMAGAGEEGTSGALTCAACGCHRSFHRRLQEYE 100
69***************************************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 9.0E-25 | 42 | 107 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 3.4E-29 | 44 | 97 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 7.5E-27 | 45 | 95 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.52 | 46 | 96 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MTLLVAEKES SKSIDKMKKC LVVLRGCEPD GRIRCSEACV RRVVRYGECQ KNHAASIGGH 60 AVDGCREFMA GAGEEGTSGA LTCAACGCHR SFHRRLQEYE AACDCSSET* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020111091.1 | 1e-73 | mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 8e-32 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A199V0Y9 | 3e-72 | A0A199V0Y9_ANACO; Mini zinc finger protein 2 | ||||
| STRING | XP_002534013.1 | 2e-32 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 3e-34 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aco001114.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




