![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aco012619.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 101aa MW: 10726 Da PI: 8.9358 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 105.1 | 4.3e-33 | 24 | 79 | 2 | 58 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
+ vrY+eC++NhAas+Gg+avDGC+Efm++ geegt+aal+CaAC CHR+FH+rev+
Aco012619.1 24 KVVRYRECRRNHAASIGGYAVDGCREFMAA-GEEGTPAALRCAACSCHRSFHKREVD 79
579**************************9.999********************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04770 | 1.8E-30 | 26 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 4.3E-26 | 27 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| ProDom | PD125774 | 1.0E-18 | 28 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.556 | 28 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009640 | Biological Process | photomorphogenesis | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0009735 | Biological Process | response to cytokinin | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0009741 | Biological Process | response to brassinosteroid | ||||
| GO:0043392 | Biological Process | negative regulation of DNA binding | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0048509 | Biological Process | regulation of meristem development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MGPKQEPKKP HSNGSAAAAR KAEKVVRYRE CRRNHAASIG GYAVDGCREF MAAGEEGTPA 60 ALRCAACSCH RSFHKREVDP PPDAATPCDC SSVSTHSRRS * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020101124.1 | 3e-67 | mini zinc finger protein 1-like | ||||
| Swissprot | B8BIU8 | 4e-29 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
| Swissprot | Q2RB28 | 4e-29 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
| TrEMBL | A0A199W957 | 8e-66 | A0A199W957_ANACO; Mini zinc finger protein 1 | ||||
| STRING | XP_008792497.1 | 3e-42 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74660.1 | 2e-26 | mini zinc finger 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aco012619.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




