PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aco014284.1

Organism

Ananas comosus

Taxonomic ID

4615

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas

Family

bZIP

Protein Properties

Length: 124aa MW: 14248.9 Da PI: 10.824

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aco014284.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	49.8	7.3e-16	41	102	1	62
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +ke kr +r+ +NR++A+ R+RKka++ eLe +vkeLe++N++L +++++l++e + l++ Aco014284.1 41 DKEHKRLKRLLRNRVSAQQARERKKAYLNELEARVKELETKNSELEERVSTLQNENQMLRQI 102 5899*****************************************************99886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00041	8.3E-5	40	56	IPR001630	cAMP response element binding (CREB) protein
SMART	SM00338	1.4E-16	41	105	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.3E-14	42	103	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	13.059	43	106	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.13E-14	45	103	No hit	No description
Gene3D	G3DSA:1.20.5.170	3.1E-18	45	105	No hit	No description
CDD	cd14704	2.63E-14	46	97	No hit	No description
PROSITE pattern	PS00036	0	48	63	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	8.3E-5	58	78	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	8.3E-5	78	95	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 124 aa Download sequence Send to blast
MYTNEIRSRY ELTSIEQREI VELGSSDGSQ RRQRSGRSSA DKEHKRLKRL LRNRVSAQQA 60 RERKKAYLNE LEARVKELET KNSELEERVS TLQNENQMLR QILKNTTVSR RGSSSSANVG 120 EGP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2oqq_A	2e-15	66	105	3	42	Transcription factor HY5
2oqq_B	2e-15	66	105	3	42	Transcription factor HY5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020089272.1	6e-60	transcription factor HY5-like
Refseq	XP_020089273.1	6e-60	transcription factor HY5-like
Refseq	XP_020089274.1	6e-60	transcription factor HY5-like
Swissprot	Q9SM50	1e-38	HY5_SOLLC; Transcription factor HY5
TrEMBL	A0A199W0G4	2e-58	A0A199W0G4_ANACO; Transcription factor HY5
STRING	GSMUA_Achr10P27050_001	1e-46	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1408	38	111

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	6e-36	bZIP family protein

Link Out ? help Back to Top
Phytozome	Aco014284.1

Publications ? help Back to Top
Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]