PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aco014816.1

Organism

Ananas comosus

Taxonomic ID

4615

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas

Family

NAC

Protein Properties

Length: 221aa MW: 24296.2 Da PI: 10.4036

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aco014816.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	91.4	1.5e-28	11	77	54	121
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdW 121 + kewyfFs rd+kyatg+r+nrat+sgyWkatgkd++v + +g +vg++ktLvfy+grapkg+ktdW Aco014816.1 11 GGKEWYFFSLRDRKYATGQRTNRATQSGYWKATGKDRSVSR-RGVVVGMRKTLVFYQGRAPKGRKTDW 77 679**********************************99.999********************* PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	27.338	1	103	IPR003441	NAC domain
SuperFamily	SSF101941	1.57E-29	9	88	IPR003441	NAC domain
Pfam	PF02365	2.5E-10	15	77	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 221 aa Download sequence Send to blast
MHGAEVACVG GGKEWYFFSL RDRKYATGQR TNRATQSGYW KATGKDRSVS RRGVVVGMRK 60 TLVFYQGRAP KGRKTDWGDW VLCRVLNKSR GLTSMPVTQT WHNVDSSSDP PPLPPLVDTF 120 TAFDRAAPSF EGHEQVPCFS NSPLLSRRAN MGGILDILSR DTNAMKGAMN HLTRFQGASN 180 SNSNSNSNSN PNSNLAQGHL ESYLVEHGLT NMFNTFSASM *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-25	11	89	69	166	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-25	11	89	69	166	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-25	11	89	69	166	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-25	11	89	69	166	NO APICAL MERISTEM PROTEIN
3swm_A	2e-25	11	89	72	169	NAC domain-containing protein 19
3swm_B	2e-25	11	89	72	169	NAC domain-containing protein 19
3swm_C	2e-25	11	89	72	169	NAC domain-containing protein 19
3swm_D	2e-25	11	89	72	169	NAC domain-containing protein 19
3swp_A	2e-25	11	89	72	169	NAC domain-containing protein 19
3swp_B	2e-25	11	89	72	169	NAC domain-containing protein 19
3swp_C	2e-25	11	89	72	169	NAC domain-containing protein 19
3swp_D	2e-25	11	89	72	169	NAC domain-containing protein 19
4dul_A	2e-25	11	89	69	166	NAC domain-containing protein 19
4dul_B	2e-25	11	89	69	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269\|PubMed:11114891}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by auxin.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020102324.1	1e-130	NAC domain-containing protein 21/22-like
Swissprot	Q84TE6	1e-43	NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBL	A0A199VDS4	1e-159	A0A199VDS4_ANACO; NAC domain-containing protein 21/22
STRING	XP_008806836.1	2e-74	(Phoenix dactylifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G56010.1	7e-32	NAC domain containing protein 1

Link Out ? help Back to Top
Phytozome	Aco014816.1

Publications ? help Back to Top
Le Hénanff G, et al. Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance. J. Exp. Bot., 2013. 64(16): p. 4877-93 [PMID:24043850] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Huo X,Wang C,Teng Y,Liu X Identification of miRNAs associated with dark-induced senescence in Arabidopsis. BMC Plant Biol., 2015. 15: p. 266 [PMID:26530097] Chen X, et al. Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis. Plant Physiol., 2016. 170(4): p. 2136-45 [PMID:26850273] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]