PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aco025594.1

Organism

Ananas comosus

Taxonomic ID

4615

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas

Family

MIKC_MADS

Protein Properties

Length: 156aa MW: 18242.9 Da PI: 10.0693

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aco025594.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	88.3	4.2e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien +nrqvt+skRr+gi+KKA+EL vLCda+v++i+fsst+k+ ey+s Aco025594.1 9 KKIENPTNRQVTYSKRRTGIMKKAKELTVLCDADVSLIMFSSTNKFSEYCS 59 68***********************************************96 PP
2	K-box	82.6	8.9e-28	71	154	1	84
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 yq+ sg +l++a++e++q+ l+ Lk+ ++nL++e+R+++Ge+L+ L++ eL+ Leq+L+++lk +R +K++++++q+++ +kk Aco025594.1 71 YQQVSGINLWSAQYERMQNTLNHLKEINSNLRKEIRQRMGEELDGLDFYELRGLEQNLDEALKVVRHRKYHVITTQTDTYKKKV 154 7899999***************************************************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.1E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.062	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.01E-38	2	95	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.42E-40	2	80	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.9E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.6E-23	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.9E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.9E-27	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.0E-19	82	154	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.072	84	155	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010093	Biological Process	specification of floral organ identity
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 156 aa Download sequence Send to blast
MGRGKIEIKK IENPTNRQVT YSKRRTGIMK KAKELTVLCD ADVSLIMFSS TNKFSEYCSP 60 STDTKKIFDR YQQVSGINLW SAQYERMQNT LNHLKEINSN LRKEIRQRMG EELDGLDFYE 120 LRGLEQNLDE ALKVVRHRKY HVITTQTDTY KKKVT*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	4e-19	1	75	1	73	MEF2 CHIMERA
6byy_B	4e-19	1	75	1	73	MEF2 CHIMERA
6byy_C	4e-19	1	75	1	73	MEF2 CHIMERA
6byy_D	4e-19	1	75	1	73	MEF2 CHIMERA
6bz1_A	3e-19	1	75	1	73	MEF2 CHIMERA
6bz1_B	3e-19	1	75	1	73	MEF2 CHIMERA
6bz1_C	3e-19	1	75	1	73	MEF2 CHIMERA
6bz1_D	3e-19	1	75	1	73	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. {ECO:0000269\|PubMed:12506001, ECO:0000269\|PubMed:12905025, ECO:0000269\|PubMed:14558657}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00077	ChIP-seq	Transfer from AT3G54340	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JN936044	0.0	JN936044.1 Guzmania wittmackii x Guzmania lingulata cultivar Ostara MADS-box2 transcription factor mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020082339.1	1e-110	MADS-box transcription factor 16-like
Refseq	XP_020095359.1	1e-110	MADS-box transcription factor 16-like
Swissprot	Q944S9	1e-87	MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBL	A0A199W550	1e-111	A0A199W550_ANACO; MADS-box transcription factor 16
STRING	XP_008781488.1	1e-101	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5728	35	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	5e-61	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Aco025594.1

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Chen ZX, et al. Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice. Planta, 2006. 223(5): p. 882-90 [PMID:16254725] Zhang Q, et al. Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull. J Genet Genomics, 2007. 34(6): p. 519-26 [PMID:17601611] Yoshida H, et al. superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] Yao SG,Ohmori S,Kimizu M,Yoshida H Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] Xiao H, et al. STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice. Plant J., 2009. 59(5): p. 789-801 [PMID:19453444] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Ohmori S,Tabuchi H,Yatou O,Yoshida H Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation. Breed. Sci., 2012. 62(2): p. 124-32 [PMID:23136523] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Lombardo F, et al. The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]