![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Aco026269.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 50aa MW: 5383.98 Da PI: 7.5231 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 55.5 | 2.4e-17 | 1 | 32 | 135 | 166 |
YABBY 135 eeiqrikasnPdishreafsaaaknWahfPki 166
eeiqrik+++P i+h+ afs+aaknWahfP+i
Aco026269.1 1 EEIQRIKTKDPTITHKAAFSTAAKNWAHFPRI 32
8*****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 5.0E-16 | 1 | 33 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 50 aa Download sequence Send to blast |
EEIQRIKTKD PTITHKAAFS TAAKNWAHFP RIPAKGDGES CSVSGEEKD* |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020099516.1 | 4e-28 | protein YABBY 7-like | ||||
| TrEMBL | F1AM02 | 6e-15 | F1AM02_ANNCH; Transcription factor INO | ||||
| STRING | XP_008812180.1 | 1e-14 | (Phoenix dactylifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 6e-13 | YABBY family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Aco026269.1 |




